SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007158 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007158
Domain Number 1 Region: 1355-1723
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.13e-100
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 2 Region: 2350-2536
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.35e-46
Family Regulator of chromosome condensation RCC1 0.0063
Further Details:      
 
Domain Number 3 Region: 1127-1308
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-30
Family APC10-like 0.0067
Further Details:      
 
Domain Number 4 Region: 951-1028
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.63e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 5 Region: 261-327
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 1.27e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 6 Region: 849-907
Classification Level Classification E-value
Superfamily UBA-like 0.0000408
Family UBA domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007158
Domain Number - Region: 2018-2104
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00384
Family Spermadhesin, CUB domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007158   Gene: ENSMLUG00000007711   Transcript: ENSMLUT00000007837
Sequence length 2536
Comment pep:putative scaffold:Myoluc2.0:AAPE02060074:923:37648:1 gene:ENSMLUG00000007711 transcript:ENSMLUT00000007837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDKWQPLLSTVAGVHRYKWLKQSAQGLPPQSALLGTIAEFALREEPVDVEKMRKCLLKQL
ERAEVRLEGIDTILKLAAKSFLLPSVQYAVFCGWQRLIPEGVDLGEPLTDCLKDVDLIPP
FNRMLLEVTFGKLYAWAVQNIRNILMDANAKFKELGIQPVPLQTVTNENPAGPSLGTTPH
ARFLLAMLSLLTLQHGAHNLTLLLNSGTLALAQTALRLIGPSGDHVEEDGNVSARGASAT
VLEETRKDTAPAQLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDG
WIRVQWDTGSTNSYRMGKEGKYDLKLAELPASAQPSAEDSDTEDDSEAEPADRNMHPTAM
MLTSTVRLLQTLCLSAGVHAEVMQGEATRTLCGLLRVVVESGTTDTTPAPNSAVCREQHR
GWCSLGFVRSIALTPHMCAALSSPPWIALLMRIVEGHAPFTAASLQRQILALHLLQAVLP
SWDKAERAEDMEGLVEKLFGFLGSLLTTCSSDVPFLRESTLRRRRARPQASLTATHSSTL
AEEAVALLRTLHSLGQWNGLINKHINSQLQAVSRSCGPTPAGGALLEDCLPDADSPEVGG
LMAVLAVIGGIDGRLRLGGQVAHEEFGEGTVTRITPKGRITVQFSDMRTCRVCPLSQLKP
LPAVPFSITSLPFTDPMLAVWAQLVNLAGSRLEKHKIKKSPKQGFAGPVDLGLLRRQQLK
LYVLKAGRALLPHQDQLRQTLAQPAVQEAAAQADDGAAASPDLGDMSPEGPQPPMILLQQ
LLAAATQPSPVKAVFARQELEAAALAVCQYLAVECAHPSSPAFEDGSSSEASTPVPAQHL
RPIRARKQRQSPVPTLPIVVQLMEMGFPRRNIELALKSLTGASGNAAGLPGVEALVGWLL
DHADAPGTDLSDPDTGSEDGSDEELLEDLDDTAYALSSGAVVTESQTYKKRADFLSNDDY
AVYVRENIQVGMMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQSDWQHKGGTYWVRYI
HVELLGYPPPSFPAHIKIGDKVRVKAAVTTPKYKWGSVTHQSVGVVKAFSANGKDVIVDF
PQQSHWTGLLSEMELVPSVHPGVTCDGCQVFPINGSRFKCRNCDDFDFCEPCFKTRRHSP
RHTFGRINEPGQSAVFCGRSGKQLKRGPSSQPGALLDSWSRMVKSLHVSSSVNQASRLID
GSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMTVDPADSSYMPSLVVVSGGNSLNNLIEL
KTINISPTDTTVSLLSDCTEYHRYIEIAIKQCRSSGIDCKIHGLVLLGRVRAEEEDWAAV
PFLASDNEEEEDEKGGAGSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVP
SFSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGMSSGTVPIPRQVTALS
SYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRD
IACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDA
QTLALTDEGLVFSWGDGDFGKLGRGGSEGCNVPQNIERLNGQGVCQIECGAQFSLALTKS
GVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGD
NDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDMATPSVHEPVLFQTA
RDPLGASYLGVPSDAESSAANNKLSGAGSSKPGRPSLAKTLLSLDGNLAKQQALSHVLNA
LQITYARDAVVGALMPASMIAPECPSFSSSAPPSEASATASPVSGEACLLAADPEDRPSP
SPWQEKRGEVIISSEDAVTPAAVTPSASSASSRPFIPVTDDPGAASIIAETMTKAKEDVE
SQNKASGPEPQALDEFTSLLVADDTRVLVDLLKLSVCGRAGDRGREVLSAVLSGMGTAYP
QVADMLLELCVTELEDVASDSQSGRLSSQPVVVESSHPYTDDTSSSGTVKIPGAEGLRVE
FDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWG
WRFTVYPIMPAAGPKDLLSDRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACA
QLSALAASHRMWALQRLRKLLTTEFGQSVNIRRLLGDSDGEARALSFTGSALAALVKGLP
ETLERQFEYEDPVVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMAS
RVAVALDRRTPLPRLFLDEVAKKIRELMADGEAMDVLHESHDVFRREHDEQLVQWMNRRP
DDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVT
ADGKLYATGYGAGGRLGVGGTESVSTPTLLESIQHVFIRKVAVNSGGKHCLALSSEGEVY
SWGEAEDGKLGHGNRSPCDRPRVVESLRGTEVVDIAAGGAHSACVTSAGDLYTWGKGRYG
RLGHSDSEDQLKPKLV
Download sequence
Identical sequences G1PA61
ENSMLUP00000007158 ENSMLUP00000007158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]