SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007170 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007170
Domain Number 1 Region: 276-601
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.37e-80
Family p120GAP domain-like 0.0000989
Further Details:      
 
Domain Number 2 Region: 561-696
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-43
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 128-288
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.48e-27
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 4 Region: 1-114
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.06e-22
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007170   Gene: ENSMLUG00000007834   Transcript: ENSMLUT00000007854
Sequence length 804
Comment pep:putative scaffold:Myoluc2.0:GL429775:11258926:11351074:1 gene:ENSMLUG00000007834 transcript:ENSMLUT00000007854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAKNLLPYLGPNKMRDCFCTINLDQEEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFY
VYDKNVLQRDLRIGKVAIKKEDLCNHSGKETWFSLQPIDSNSEVQGKVHLELKLNELITE
NGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKTKVKKKTSNPQFNEIF
YFEVTRSSSYTRKSQFQVEEEDIEKLEIRIDLWNNGNLVQDIFLGEIKVPVNVLRNDTSH
QAWYLLQPRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISAS
AAYILGEICRDKNDAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRC
LDEMMKIVGGHYLKVTLKPILDEICESSKSCEIDPIRLKEGDNVENNKENLRYYVDKLFS
TIIKSSMSCPTVMCDVFYSLRQMAAQRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHL
RPHHPDAPTIRTLTLISKTIQTLGSWGSLSKSKSSFKETFMCEFFKMFQEEGYILAVKKF
LDEISSTETKESSGTSEPVQLKEGEMYKRAQGRTRIGKKNFKKRWFCLTSRELTYHKQPG
KDALYTIPVKNILAVEKLEDSSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDVLCRVSR
CNQNRLSSYHPSAYLNGSWLCCQETSESALGCKPCTAGVPADIQIDIDEDRETERIYSLF
TLSLLKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHE
KYRKKRSSSAKYGSKENPIGGKAS
Download sequence
Identical sequences G1PA71
ENSMLUP00000007170 ENSMLUP00000007170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]