SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007291 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007291
Domain Number 1 Region: 202-496
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 8.5e-42
Family Galactose oxidase, central domain 0.015
Further Details:      
 
Domain Number 2 Region: 646-793
Classification Level Classification E-value
Superfamily C-type lectin-like 7.87e-21
Family C-type lectin domain 0.0048
Further Details:      
 
Domain Number 3 Region: 2-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-20
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 4 Region: 926-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007291
Domain Number - Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00733
Family Integrin beta EGF-like domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007291   Gene: ENSMLUG00000007943   Transcript: ENSMLUT00000007983
Sequence length 1292
Comment pep:putative scaffold:Myoluc2.0:GL429945:839069:983566:1 gene:ENSMLUG00000007943 transcript:ENSMLUT00000007983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSIYAP
LIAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFDMCPNNCSGR
GECKISNSSNTAQCECSENWKGEACDIPHCVNNCGFPYRGICNSSDVRGCFCFSEWQGPG
CSIPVPANQSFWTQEEYSNPRLPRASHKAVVNGNTMWIVGGYMFNHSDYSMVLAYDLASR
EWLALNRSVNNVVIRYGHSLALYKDKIYMYGGKIDSTGNVTNELRVFHIHNESWVLLAPK
AKEQYAVVGHSAHIVTLKTGRVVMLVIFGHCPLYGYISSIQEYDLDKNTWSILHTQGALV
QGGYGHSSVYDHRTRAVYVHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFFRYLH
TAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPDLHHDVNRFGH
SAVLHNSSMYVFGGFNSLLLSDILVFTSERCEAHQSEAACLAAGPGIRCVWDTGSSQCIS
WELATEAQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDCHWCNDYCVPKNHSCTEG
QISISKYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGSGWHLVVN
MCLKISTAKETYDTAKLSCRNHNALLASLTTQQKIDFVLKQLRIMQSSQSMTKLTLTPWV
GLRKINVSYWCWEDMSAFTNSSIQWMPFEPSDAGFCGILSEPSTRGLKAATCINPLNGSV
CEKLANHSTKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYVASFPYGQCMEWY
TMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAPIGNFY
PQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGFY
GDPTNGGKCQLCKCNGHASLCNTNSGKCFCTTKGVKGDECQLCEVENRYQGNPLKGTCYY
TLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFSAGT
QAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHQNITFFVYVSNFTWPIKIQIAFSQHSNFM
DLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVNVALET
DEEPPDLIGGTIKAVPKPIALEPCFYYKAAVLSAFVRLPRGLGGIPPPGQSGLAVASALV
DISQHLPVLYKEKLGALRNRKQQPPAQPGTCI
Download sequence
Identical sequences G1PAH9
ENSMLUP00000007291 ENSMLUP00000007291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]