SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007325 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007325
Domain Number 1 Region: 47-162,210-294
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.51e-20
Family DNA gyrase/MutL, N-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007325
Domain Number - Region: 774-827
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0327
Family RILP dimerisation region 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007325   Gene: ENSMLUG00000007987   Transcript: ENSMLUT00000008019
Sequence length 936
Comment pep:putative scaffold:Myoluc2.0:GL429769:29036065:29115213:1 gene:ENSMLUG00000007987 transcript:ENSMLUT00000008019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLYRGAPAGPGAPGSGLARPGGSPQAFWIRLSTMSPRYLQSNSSSHTRPFSAIAELLDN
AVDPDVSARTVFIDVEEVKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPIGV
FGNGFKSGSMRLGKDALVFTKNGGTLTVGLLSQTYLEYVQAQAVIVPIVPFNQQNKKMII
TEDSLPSLEAILNYSIFNSENDLLSQFDAIPGKKGTRVLIWNIRRNKDGKSELDFDTDQF
DILVSDFGTEEKETGGVTSELPETEYSLRAFCGILYMKPRMKIFLRQKKVTTQMIAKSLA
NVAYDIYKPTFTNKQVKITFGFSCKNNNQFGIMMYHNNRLIKPFEKVGCQVKPTHGEGVG
VIGVIECNFLKPAYNKQDFEYTKEYRLTINALAQKLNVYWKEKTSQENFETSAIARIIPK
LDDITFEGCNEDYKKRRKLPGKVDPSTLPARWFVTIIPIPKYRRCSVPEEQELMDEDLYL
SKAKKQDQTVEKKKVPLENEDHQVFTNPLKIPTIQDMDELNSQTIGYEEIDSPSRFPSVG
EGSKTPPLQLKPLDSSVFQFSSKYKWILGEEPVEKRRRLQNEMTTPLDYSMPGSYRRVEA
AVAYPEGENSHDKSSSERSTPPYLSPEYPDASKSTSQSREASVLYSGAQEHQGSLLPEEL
EDQMPRLVAEESNRGSTNINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERR
KAAESWNPMPYPTVASATSPAAAAGEKGKGYEESGGHNTPKLKNQRELEELKRTTEKLER
VLAERNLFQQKVEELEQERNHWHSEFKKVQHELVTYSTQETEGLYWSKKHMGYRQAEFQI
LKAELERTKEEKQELKEKLKETETHLEVLQKAQVSYRTPEGDDLERALAKLTRLRIHVSY
LLTSVLPHLELREIGFDSEQVDGILYTVLEANHILD
Download sequence
Identical sequences G1PAK9
ENSMLUP00000007325 ENSMLUP00000007325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]