SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007387 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007387
Domain Number 1 Region: 1-230
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-73
Family Nuclear receptor ligand-binding domain 0.00000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007387   Gene: ENSMLUG00000008091   Transcript: ENSMLUT00000008088
Sequence length 231
Comment pep:putative scaffold:Myoluc2.0:AAPE02069670:521:2351:-1 gene:ENSMLUG00000008091 transcript:ENSMLUT00000008088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGF
AGLDLNDQVTLLKYGVYEAIFAMLASVMNKDGMLVACGSGFITREFLKSLRKPFCDIMEP
KFDFAMKFNALELDDSDIALFVAAIICCGDRPGLLHVGQIEKMQEGIVHVLRLHLQGNHP
DAAFLFPKLLQKMADLRQLVTEHAQLVQVIKRTEADAALHPLLQEIYRDMY
Download sequence
Identical sequences L7N1F6
ENSMLUP00000007387 ENSMLUP00000007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]