SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007432 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007432
Domain Number 1 Region: 280-602
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-89
Family p120GAP domain-like 0.0000732
Further Details:      
 
Domain Number 2 Region: 560-696
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-47
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 129-290
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.99e-27
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 4 Region: 3-116
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.02e-23
Family Synaptotagmin-like (S variant) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007432   Gene: ENSMLUG00000008114   Transcript: ENSMLUT00000008141
Sequence length 817
Comment pep:putative scaffold:Myoluc2.0:GL430162:670264:747416:-1 gene:ENSMLUG00000008114 transcript:ENSMLUT00000008141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGEAKNLPTYPGPNKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEIPRSFRHLS
FYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDADSEVQGKVHLELRLSEVI
TDTGVVCHKLATRILECQGLPIVNGQCDPYATVTLAGPYRSEAKKTKVKKKTNNPQFDEV
FYFEVTRPCSYSRKSHFDFEEEDVDKLEIRVDLWNASNLKFGDEFLGELRIPLKVLRQSS
SYEAWYFLQPRDNGSKSLKPGDLGSLRLNVVYTEDHVFSSDYYSPLRDLLLKSADVEPVS
ASTAHILGEVCREKQEAAIPLVRLFLHYGRVVPFISAIANAEVRRTQDPNTIFRGNSLTS
KCIDETMKLAGMHYLHVTLKPTIEEICQSHKPCEIDPVKLKDGENLENNMENLRQYVDRI
FNVITKSGVSCPTVMCDIFFSLREAAAKRFQDDLDVRYTAVSSFIFLRFFAPAILSPNLF
QLTPHHTDPQTSRTLTLISKTIQTLGSLSKSKSASFKESYMAAFYEFFNEQKYADAVKNF
LDLISSSGRRDPKSVEQPILLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYQKSKG
DQPLYSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQANNCVEAKAWIDILTKVSQ
CNQKRLTVYHPSAYLNGHWLCCRASSDTAPGCSPCTGGLPANIQLDIDGDRETERIYSLF
NLYMSKLEKMQEACGSRSVYDGPEQEEYLTFIIDDPQETYKTLKQVIARVGALEQEHAQY
KRDKFKKTKYGSQEHPIGDKSFQSYIRQQSEVSTHSI
Download sequence
Identical sequences G1PAU5
ENSMLUP00000007432 ENSMLUP00000007432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]