SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007673 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007673
Domain Number 1 Region: 66-279
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.38e-54
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 287-328
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000615
Family SOCS box-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007673   Gene: ENSMLUG00000008409   Transcript: ENSMLUT00000008409
Sequence length 329
Comment pep:putative scaffold:Myoluc2.0:GL430076:1129485:1177931:1 gene:ENSMLUG00000008409 transcript:ENSMLUT00000008409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALEDGRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
AAPGQGSWADRSPLHEAASQGRLLALQTLLSQGYNVNAVTIDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSPCCAELLLEYGAKPQLESCLPSPTHEAASKGH
HECLQILISWGIDVDQDIPHLGTPLYVACMSQQFHCIRKLLYAGADVQKGKYWDTPLHAA
AQQSNTEIVHLLLEFGADINAKNTELLRPVDVASSSSLVERMLLQHEATPSSLCQLCRLC
IRRRIGRPRLHLIPQLQLPTLLQNFLQYR
Download sequence
Identical sequences G1PBE8
ENSMLUP00000007673 ENSMLUP00000007673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]