SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007755 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007755
Domain Number 1 Region: 2377-2449
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.27e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 993-1062
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-19
Family TB module/8-cys domain 0.00068
Further Details:      
 
Domain Number 3 Region: 1728-1799
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.28e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 2092-2163
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 354-420
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-18
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 6 Region: 2170-2304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 577-701
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.12e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 8 Region: 1889-2015
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 490-617
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 2492-2620
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 1069-1199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.61e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 12 Region: 1359-1491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000011
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 1568-1641
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000196
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 14 Region: 208-293
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000209
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 15 Region: 693-765
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 16 Region: 1451-1578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000643
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 1235-1377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000107
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 18 Region: 889-972
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000017
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 19 Region: 2263-2379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000471
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 20 Region: 755-897
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 2617-2735
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000439
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 22 Region: 1647-1702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 23 Region: 1197-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000551
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 24 Region: 2053-2106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 25 Region: 312-359
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000535
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 26 Region: 2448-2499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000628
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 27 Region: 1806-1860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 28 Region: 2008-2050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000312
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 29 Region: 1849-1887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000723
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007755
Domain Number - Region: 179-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00318
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2828-2874
Classification Level Classification E-value
Superfamily Cadherin-like 0.0126
Family Cadherin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007755   Gene: ENSMLUG00000008374   Transcript: ENSMLUT00000008504
Sequence length 2913
Comment pep:putative scaffold:Myoluc2.0:GL429767:1994842:2236683:1 gene:ENSMLUG00000008374 transcript:ENSMLUT00000008504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRRQCLQPYFVWLGCVALWAQGSAGQPQPPPPKPPGPQPLQQVRPAATGSEGGFAVP
EYREEGAVVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGD
GFCSRPNMCTCSSGQISPTCGSKSIQQCSVRCMNGGTCAEDHCQCQKGYIGTYCGQPVCE
NGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCA
TIGRAWGHPCEMCPAQPQCRRGFIPNIRTGACQADVDECQAIPGICQGGNCINTVGSFEC
KCPAGHKQSETTQKCEDIDECSVIPGICETGECSNTVGSYFCICPRGYVTSTDGSRCIDQ
RSGTCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGLGTIPEACPVRGSEEYQRLCMDGL
PIGGIPGSAGSRPGGTGGNGFAPNGNGNGYGPGGAGFIPIPGGNGFSPGVGGAGVGAGGQ
GPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECTS
NPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCI
CNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVDE
CQTPGICMNGHCINNEGSFRCDCPPGLAVGVDGRVCVDTHMRSTCYGGIKKGVCVRPFPG
AVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICAN
GICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPGY
VFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIVSLQRTCWLN
IQDNRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGFARIKGVTCEDVNECEV
FPGVCPNGRCINSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECVHPVPGKFR
MDACCCAVGAAWGTECEECPKPGTKEYDTLCPRGPGFANRGDVLTGRPFYKDINECKAFP
GMCTYGKCRNTIGSFKCRCNNGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECE
CFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI
NECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSE
GSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMK
TCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMH
ASCLNVPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFT
GDGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNIC
VFGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPD
FQLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETC
PPVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGY
YLSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCY
RSYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDI
HTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLC
QRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHN
GFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFF
GQVCRNGRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRC
ICPPGYEVKSENCIDINECDEDPNICLFGSCTNTPGGFQCICPPGFVLSDNGRRCFDTRQ
SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGT
VPSLHDTREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGN
PCGNGTCTNVIGSFECNCNEGFEPGPMMNCEDINECAQNPLLCAFRCMNTFGSYECTCPI
GYALREDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMTRRPDGEGCIDENE
CRTKPGICENGRCVNTIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTMCQMASSS
RNLVTKSECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCT
NGQCINTMGSFRCFCKVGYTTDISGTSCVDLDECSQSPKPCNFICKNSEGSYQCSCPRGY
VLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSL
CGAKGICQNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQ
GYIQHYQWNQCVVIDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNEC
SSSKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLPMDTEVDEENALSP
EACYECKINGYSKKEGRQKRSVHEPEPSAVEQISLESVDMDSPMRMKFNLSGLGSKEHIL
ELMPAIEPLNNHIRYVISQGNDDGIFRIHQRNGLSYLHTAKRKPVPGTYTLEIMSIPLYK
KKELKKLEDSNEDDYLLGELGEALRMRLQIQLY
Download sequence
Identical sequences G1PBK9
ENSMLUP00000007755 ENSMLUP00000007755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]