SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007769 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007769
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.02e-20
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 2 Region: 62-131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.32e-19
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 242-310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-19
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 4 Region: 358-429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.04e-17
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 120-190
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 418-487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 476-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-16
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 8 Region: 538-606
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000135
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 299-363
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 174-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 11 Region: 597-655
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000135
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007769   Gene: ENSMLUG00000008452   Transcript: ENSMLUT00000008521
Sequence length 820
Comment pep:putative scaffold:Myoluc2.0:GL430848:31468:59656:-1 gene:ENSMLUG00000008452 transcript:ENSMLUT00000008521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAGHCGSPDPIVNGHISGDGFSYRDTVVYQCHAGFRLVGTSVRICLQDHKWSGQTPVCV
AITCGHPGNPAHGLTNGSQFNLNDVVNFTCNTGYVLQGAPQAQCRSNGQWSSPLPTCRVV
NCSDPGSVDNAVRQSVPESLVYGRTVVYHCKKGFYLLGSSALTCTASGLWDRSLPKCLAI
SCGHPGVPANAILTGDVFTFGATVHYSCQGARSLVGDHSRVCQEDGHWSGALPHCTGNHP
GFCGDPGTPAHGSRLGDEFKAKSLLRFSCEVGYLLRGSPERTCLLNGSWSGQQPACEAVS
CGNPGTPTNGMIVSSDGILFSSSVVYACWEGYRTSGLTTRHCTANGTWTGTAPDCTIISC
GDPGTPANGIQFGTDFTFNKTVSYQCSPGHVLEPASGATLRCLGDGAWSHGRPVCRAVLC
SPPPPVLHGEVEGTDFRWGASISYSCAAGYQLSHPAILSCEGPGVWKGETPQCLPVFCGD
PGTPAEGQLSGKSFTYKSEVSFQCRPPFVLVGSPRRTCQADGAWSGVQPACIDPAHNTCP
DPGTPHFGIQNSSRGYEVGSSVFFRCRKGYHVQGSTTRTCLANLTWSGIQTECIPHACRQ
PETPAHADVRAIELPAFGYTLVYTCHPGFFLAGGSEHRTCKADLKWTGKSPVCKIPSDVF
FVGSVWKGHYEYLGKRQPATLTVDSFNATRSRVNATFAAASQVELKLTEDHKPVQKSRYT
RCCHSPKGSGLYPFKIDNTLIRSDPKVSSGLERGGFTFQGDVRGEDFGKFKLERQDALSS
DQDAAHRHLGTSSGSVAAAILVPFFALILSGFAFYLYKHR
Download sequence
Identical sequences G1PBM2
ENSMLUP00000007769 ENSMLUP00000007769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]