SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007833 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007833
Domain Number 1 Region: 777-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-22
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 2 Region: 282-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 4-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000204
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 244-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000114
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 594-753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000236
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 131-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000013
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007833   Gene: ENSMLUG00000008561   Transcript: ENSMLUT00000008594
Sequence length 962
Comment pep:putative scaffold:Myoluc2.0:GL430114:31028:50320:1 gene:ENSMLUG00000008561 transcript:ENSMLUT00000008594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPDVDECVEGTDSCHIDALCQNTPRSYKCICKSGYTGDGKHCKDVDECEREDNAGCVHD
CVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGSYECHCREGFSAT
PAHLHQRPEEGMNCMNKNHGCAHICRETPKGGIACECRPGFELTKNQRDCKLTCNYGNGG
CQHTCDDTEQGPRCGCHVKFVLHTDGKTCIGGWEPSFLEDTRQDQAGDSDSPSIARRPLP
TETCAVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNGGCDHICRNTV
GSFECSCKKGYKLLINERNCQDIDECSFDRTCDHMCVNTPGSFQCLCHHGYLLYGVTHCG
DVDECSINRGGCRFGCINTPGSYQCTCPAGQGRLHWNGKDCTEPVKCQSSPGASKAMLSC
NRAGKKDTCALTCPSRARFLPEAAVLSVKQRASFKIKDAKCRLHLRNKGKMEEASRILGP
GAASCSDCQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEETTASCGLPC
LRQRMERRLKGSLKMLRKSINQDRFLLRLAGLDYELAHKPGPVAGERAELVEACRPGQHR
AGAKCVSCPQGTYYHGQTEQCVPCPAGTFQEREGQLSCDLCPGSDAHGPLGATNVTTCAG
QCSPGQHSVDGFKPCQPCPRGTYQPEAGRTLCFPCGGGLTTKHEGATSFQDCDTKVQCSP
GHYYNTSIHRCIRCAMGSYQPDFRQNFCTRCPGNTSTDFDGSTSVAQCKNRQCGGELGEF
TGYIESPNYPGNYPAGVECVWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSS
ITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTYDEDYEQLVEDIVRDG
RLYASENHQEILKDKKLIKAFFEVLAHPQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRP
YK
Download sequence
Identical sequences G1PBS6
ENSMLUP00000007833 ENSMLUP00000007833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]