SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007856 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007856
Domain Number 1 Region: 132-474
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-79
Family Protein kinases, catalytic subunit 0.0000000000504
Further Details:      
 
Domain Number 2 Region: 6-129
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-32
Family Regulator of G-protein signaling, RGS 0.00000191
Further Details:      
 
Domain Number 3 Region: 501-609
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-24
Family Pleckstrin-homology domain (PH domain) 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007856   Gene: ENSMLUG00000008609   Transcript: ENSMLUT00000008618
Sequence length 635
Comment pep:putative scaffold:Myoluc2.0:GL430158:914506:956965:-1 gene:ENSMLUG00000008609 transcript:ENSMLUT00000008618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIFYSFPLGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLSRSRQIYDTYIMK
ELLSCSHPFSKQAVDHVQYLLSKKQVTSALFQPYIEEICESLRGNIFQKFMESDKFTRFC
QWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKIPAMKTLDKKYSRPLLSQSY
TELLQTQGSAWLQRSGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKE
MRFYATEIILGLEHMHHRFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGT
HGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVDL
PDAFSPELRSLLEGLLQREVGKRLGCHGGGSQEVKEHSFFRGIDWHHVYLQKYPPPLIPP
RGEVNAADAFDIGSFDEEDTRGIKLLDCDQELYKNFPLVISERWQQEVVETIYETVNSDT
DKIEARKRAKNKQLGHEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGE
GESRQNLLTMEQIMSVEETQFKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETFTE
AQRLLRRAPKFLNKSRAGVAELAKPPLCHRSSNGL
Download sequence
Identical sequences G1PBU7
ENSMLUP00000007856 ENSMLUP00000007856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]