SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007868 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007868
Domain Number 1 Region: 42-196
Classification Level Classification E-value
Superfamily EF-hand 3.01e-27
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily EF-hand 0.00000447
Family Parvalbumin 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007868   Gene: ENSMLUG00000008627   Transcript: ENSMLUT00000008633
Sequence length 240
Comment pep:putative scaffold:Myoluc2.0:GL429855:3267579:3278817:-1 gene:ENSMLUG00000008627 transcript:ENSMLUT00000008633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNGYIEGKELENFFQELEKTRKVSGMGPKSEILPQRASVFSKKYDKNSDGKIEMAELAQI
LPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPK
LQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLNSEEFNAIFTFYDKDG
SGYIDENELDALLKDLYEKNKKEMNIQELTNYRKSVMSLAEAGKLYRKDLEIVLCSETPL
Download sequence
Identical sequences G1PBV7
ENSMLUP00000007868 ENSMLUP00000007868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]