SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007987 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007987
Domain Number 1 Region: 916-1092
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 489-605
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.02e-32
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 264-379
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-22
Family Pleckstrin-homology domain (PH domain) 0.00065
Further Details:      
 
Domain Number 4 Region: 1175-1322
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-17
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000884
Family SAM (sterile alpha motif) domain 0.005
Further Details:      
 
Domain Number 6 Region: 601-784
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000493
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 7 Region: 389-488
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000257
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 8 Region: 799-907
Classification Level Classification E-value
Superfamily PH domain-like 0.000000157
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 9 Region: 1132-1195
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000282
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007987   Gene: ENSMLUG00000008745   Transcript: ENSMLUT00000008765
Sequence length 1542
Comment pep:putative scaffold:Myoluc2.0:GL429795:4197285:4217965:1 gene:ENSMLUG00000008745 transcript:ENSMLUT00000008765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGICATGHRKRILR
LLQTGAAEGSPDPQLDRAMEPSSSPAPQAQPPKPVPKPRTVFGGLSGPTTTQRPGLSPAL
LRPEVPRSPESSPRSLPLPTTSSEQPSALNTVEMMPNAIYFGLDLRGGAQTAQDTAPDSS
QTAAPTPALRPTTGTVHIMDPGCLYYGVQPVGVPGAPNRREGRGVCQDRAEHRLSRQDLE
TREDAGYASLELPGDSALSLPTLNTEETSDDLISPYASFSSTADRPMPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGNDKTLSPKGVIPLSAIEMRSSKDNKFQVITSQRVFVFRT
ESEAQRDTWCSTLQSCLKEQRLLGHPRAPQLPRPLRTGMLELRGHKAKVFAALSPGELAL
YKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQEA
VTETLSDYEVAEKIWSNRANLHCADCGASRPDWAAVNLGVVICKQCAGQHRALGSGISKV
QSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGALPPGERINPDTTPGPRGEFISRKYRLG
LYRKPHPQHPDHSQLLQALCAAVAGPNLLKNMTQLLCVEASEGEEPWSPSALDGSFPGLL
PPDPSLDVYNEVVVPATYSSFLYCGPISNKAGPPPPRRGRDAPSRLWCVLGAALEMFVSE
SSPEPLSLIQPQDVVCLGVSPPPTDSGDLDRFPFSFELILTGGRIQHFGTDGADSLEAWV
NAVGKWFSPLSCHQLLGPGLVRLGRLWLRSPSYTALAPGLWLSGFGLLRGDHLFLCPAPG
PGPAVPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFSAWNVAIG
GAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLADFRR
DARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEV
IGCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQE
LIDGYVSVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVS
PTLTAEELTNQVLEMRGTAAGTDLWVTFEILEHGELERPLHPKERVLEQALQWCQLPEPC
SASLLLRKVSLAQASCLFTGVRRESPRVGLLRCREEPPRLLGNRFQERFFLVRGRCLLLL
KEKKSSKPEREWSLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTS
ILKAQHDDQQPVVLRRRSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTL
SMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTKDTSTSFFTMREQTAKSETPL
TSRRSSDQPLLSKTGWEERPPEPPPGPPSKNSPQAQSSLEEQLLQELSSLILRKGETTIG
LGSPSQPSSPQPLSPNNHPTQTPGFPSPPPCTSSLPSSQPLT
Download sequence
Identical sequences G1PC57
ENSMLUP00000007987 ENSMLUP00000007987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]