SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008278 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008278
Domain Number 1 Region: 25-140,190-271
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.76e-19
Family DNA gyrase/MutL, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008278   Gene: ENSMLUG00000009058   Transcript: ENSMLUT00000009086
Sequence length 990
Comment pep:putative scaffold:Myoluc2.0:GL429834:5633286:5771362:-1 gene:ENSMLUG00000009058 transcript:ENSMLUT00000009086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKYATLRRAQLHLDFIHANSTTHSFLFGALAELLDNARDAGAARLDVFSVDNEKLQGG
FMLCFLDDGCGMSPEEASDIIYFGTSKKRLSTLKFIGQYGNGLKSGSMRIGKDFILFTKK
EETMTCVFFSQTFCEEEGLSEVVVPMPSWLTKNREPVIDDPQKFSTELSIIYKYSPYKTE
AELMRQFDIIYGKCGTLLVIYNLKLLLSGEPELDVKTDKEDILMAEALEDFPERWSFRAY
TSVLYFDPRMRIFIQAKKVKTKHLCHCLYKPRKYLYVTSSFKGAFKNEVKKAEEAVKIAE
LVLKDARIRVNQPDRTSLPSPAKDVLQKALEDVEAKHKILKEKRRELKTARTLSLFFGVN
TENRNHAGMFIYSNNRLIKMHEKVGPQLKLKSLLGAGVIGIINIPLEVMEPSHNKQEFLN
VQEYNHLLRVMGQFLVQYCKDTGISNRNLTLFWNEFGYQNNKDTERSLESIQYQRRQAMA
IPFIIQCDLCLKWRVLPPSTDYLEKELLDAWICANNPNLSENSCHQAERLPPIPLGTMST
VSLSKNEKEKRLQESVRRYQDQLAEQQLELQFIPKSRIAESTTICRISASKENTKPRKIR
PSGYDLKHESFASFELSAAQRSWKSNTEGTDSDVEFVSETKVMKSTRKKEEPQQRHPAAL
PEKVRLTERSQEIAVAHQQNVWRAQPTERPPKNMPASSWEMKRKENQNLVQECQGLIEVE
TSNSDQDLILILDQSDNNVFLKHEKKEVPLMKKEKQELCSDIAEIKRNSSLPNWKRLLNI
PVEDLGPGSGHRARVAVSSGCEVGSSLTKSSQSPSVKETVRKLASNLWEIILYFFPEYQL
PSEIGYSSVEEFVASLELEQCTEQTNRKLKMCFQQIQDVYMAQYAKKLKRTTQSIIYDAN
RRGVINEISLVQCEQKRKITEDRLNNLRVKLAALLQKLQLGGPVGDMEQIDSYLEALLKE
DHLLGNTFNKGSTDAGHSLPLENNESTSQN
Download sequence
Identical sequences G1PCW5
ENSMLUP00000008278 ENSMLUP00000008278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]