SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008371 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008371
Domain Number 1 Region: 102-271
Classification Level Classification E-value
Superfamily EF-hand 9.94e-43
Family Penta-EF-hand proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008371   Gene: ENSMLUG00000009193   Transcript: ENSMLUT00000009184
Sequence length 276
Comment pep:putative scaffold:Myoluc2.0:GL429898:3636804:3643018:1 gene:ENSMLUG00000009193 transcript:ENSMLUT00000009184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGTLLFLQASSETGEQAPGALPSSCYPGGGQYGSGVPPGGGYGGAPAPGGPYGYPNPGGL
PSGAPGGPYGGAAPGTPYGQPPPNPYGAPPPAPYGQGPPPGGAPPNVDPEAYSWFQSVDS
DHSGYISVKELKQALVNSNWSTFNDETCLMMINMFDKTKAGRIDVHGFSALWKFIQHWKN
LFQQYDRDRSGSISYTELQQALSQMGYNLSPQFSQLLVSRYCPRSASPAMQLDRFIQVCT
QLQVLTEAFREKDTAMQGNVRLSFEDFVTMTASRML
Download sequence
Identical sequences G1PD47
ENSMLUP00000008371 ENSMLUP00000008371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]