SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008412 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008412
Domain Number 1 Region: 447-701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.57e-71
Family Eukaryotic proteases 0.00000000544
Further Details:      
 
Domain Number 2 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00011
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.0000271
Further Details:      
 
Domain Number 4 Region: 376-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000764
Family Complement control module/SCR domain 0.000022
Further Details:      
 
Domain Number 5 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000903
Family Complement control module/SCR domain 0.0000121
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008412   Gene: ENSMLUG00000009230   Transcript: ENSMLUT00000009230
Sequence length 705
Comment pep:putative scaffold:Myoluc2.0:GL429777:8442335:8449639:-1 gene:ENSMLUG00000009230 transcript:ENSMLUT00000009230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWLLYLLASVLFCKVGGSMPIAQDLYGEVTSPLYPKPYPNNFETTTVITVPTGYRVKLVF
WQFDLEPSEDCFYDYVKISADKKTLGRFCGQLGSPLGNPPGEKEFISEGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASQQNTVEKNPQPLCQHLCHNYVGGYFCSCRPGY
ELQKDGHSCQVECSSELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGYTIHLKFLEPF
EIDDHQQVHCPYDQLQIYTSGRNIGEFCGKQRPADLDTSSNAVDLLFFTDESGDSRGWKL
HYTTSIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLPSFTAVCQD
DGTWHRAMPRCKIKDCGQPRSLRNGVFKYTTTKGVNTYQARIQYHCNEPYYKMKTRDGSS
ESEQGTYTCTAQGIWKNEQEGEKIPRCLPVCGKPVNPVEQKQRIIGGQNAKMGNFPWQAF
TNIYGRGGGALLGDRWILTAAHTLYPKEHNAQANASIDVFLGHVNVEEITKLANHPVRRV
SIHPDYRQDESHNFEGDIALLELENSVTLGPNLLPICLPDNETFYDSGLMGYVSGFGIME
ERIANNLRFVRLPVANRGLCERWLRGKNRNDVFSQNMFCAGDPTLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKLLNYVDWIKKEMEEEG
Download sequence
Identical sequences G1PD83
ENSMLUP00000008412 ENSMLUP00000008412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]