SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008569 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008569
Domain Number 1 Region: 266-393
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.2e-40
Family Regulator of G-protein signaling, RGS 0.0000298
Further Details:      
 
Domain Number 2 Region: 191-255
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.12e-18
Family Transducin (heterotrimeric G protein), gamma chain 0.0025
Further Details:      
 
Domain Number 3 Region: 3-73
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-18
Family DEP domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008569   Gene: ENSMLUG00000009389   Transcript: ENSMLUT00000009403
Sequence length 434
Comment pep:putative scaffold:Myoluc2.0:GL429974:927460:1000798:1 gene:ENSMLUG00000009389 transcript:ENSMLUT00000009403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIAGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYVFPISDHVLTMKDDGTFYRFQAPYF
WPSNCWEPENTDYAIYLCKRTMQNKARLELADYESENLARLQRAFARKWEFIFMQAEAQV
KIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTE
ESQSQSPVHIPSQPVRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDP
MITPAEPSNPWISDDVTLWDIEMSKEPSQQRVKRWGFSFDEMLKDQVGRDQFLRFLESEF
SSENLRFWLSVQDLKKQPLQDVAKRVEEIWQEFLSPGAPSAINLDSHSYEITSQNVKDGG
RYTYEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKPESEQGRRTSLEKFTRSVVSSA
GFVPSRAFGFLSSF
Download sequence
Identical sequences G1PDL8
ENSMLUP00000008569 ENSMLUP00000008569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]