SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008619 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008619
Domain Number 1 Region: 50-186
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-38
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 373-474
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-32
Family Ras-binding domain, RBD 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008619   Gene: ENSMLUG00000009425   Transcript: ENSMLUT00000009455
Sequence length 561
Comment pep:putative scaffold:Myoluc2.0:GL429768:2176520:2189408:1 gene:ENSMLUG00000009425 transcript:ENSMLUT00000009455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVLAVSDGELSSTVGPQDQSEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWGLSFERLLQDPLGLAYFTEFLKKEFSAENLTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWVGEEMLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
RECLLAEAQGRPLREPDSLRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPAEGPGGRPL
RKSFRRDCPSLKWPFGGALTSSATRSTQMHLTYESFPLVRGVLKKVSWKRQQLRRRRRRR
SCGGSEGLEEEMRPAGLGGIHMPEGQAILPPFSLALAIPDSASSQVPNASSSVPLPCPSA
LPSKLQKALVLDQDCTVLADQEVRLENRITFQLELAALQRVVLISAKPTKRLQEALQPIL
AKHGLSAHQIELRRPGEKQPLDLGKLVSSVAAQRLVLDTLPGVKISETGDTHPRRSQRTT
PGTQDKGIHLPPLPLNSLAEAPSSVTGNRQTCDIEGLVELLNRVQSSGAHDQRGLLRKED
LVLPEFLQLPAPGPNSQEAPP
Download sequence
Identical sequences G1PDR0
ENSMLUP00000008619 ENSMLUP00000008619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]