SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008776 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008776
Domain Number 1 Region: 91-216
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-34
Family DEP domain 0.0054
Further Details:      
 
Domain Number 2 Region: 5-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.62e-29
Family DEP domain 0.0011
Further Details:      
 
Domain Number 3 Region: 282-326
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000154
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008776   Gene: ENSMLUG00000009641   Transcript: ENSMLUT00000009631
Sequence length 370
Comment pep:putative scaffold:Myoluc2.0:GL429784:7757133:7813667:1 gene:ENSMLUG00000009641 transcript:ENSMLUT00000009631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHH
VCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRLYEKLMSPEHTLLQPREEEGVK
YERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEYGIIQHVSNKHPFVDSNLLYQFRMN
FRRRRRLMELLNEKSPSQEMHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSM
SSCGSSGYFSSSPTLSSSPPVLCNPKSVLKRPVTSEELLTPGAPYARKTFTIVGDAVGWG
FVVRGSKPCHIQAVDPSGPAAAAGMKEVCSSVLGIKYVETLDEAQRTTQTLLEVLAPRSC
ALQVMEALLA
Download sequence
Identical sequences G1PE50
ENSMLUP00000008776 ENSMLUP00000008776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]