SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008911 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008911
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008911   Gene: ENSMLUG00000009758   Transcript: ENSMLUT00000009773
Sequence length 492
Comment pep:putative scaffold:Myoluc2.0:GL429767:282730:305798:-1 gene:ENSMLUG00000009758 transcript:ENSMLUT00000009773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAAKKGPGPGGGVGGGKTEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
LIPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPTYTKGSASTPIQGSIPEGKPLRTLLG
DPVSSLSADASTSSQSVSQSQARISQPRSAQPPPHSSVKKASTDLLADIGGDPFAAPQTV
PSFAAFPAFGAIGQTPSHGGFANFDAFGSSPSSSAFGSIPLARQTPFQAQPTATASGMLT
GSYSFGSSQVTPFGAASLAPASQPNSLTDMGGLLGPGASAGGIPSSIFGMTSQVPTLQSA
TTGGGGSTGLAFGAFTNPFTAPAAHPQLPSTNPFQPNGLATGPGFGMSSAGPGFSQTVPP
TGAFATTFPPPMFSLQTSMPPHQNGSSFSDLGPAKLEQRPLSQPGGISTNPFMTGSSSSP
FASKPPTTNPFL
Download sequence
Identical sequences G1PEG7
ENSMLUP00000008911 ENSMLUP00000008911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]