SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009052 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009052
Domain Number 1 Region: 75-217
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.47e-41
Family Regulator of G-protein signaling, RGS 0.0000000829
Further Details:      
 
Domain Number 2 Region: 785-866
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-27
Family DIX domain 0.00000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009052   Gene: ENSMLUG00000009934   Transcript: ENSMLUT00000009929
Sequence length 866
Comment pep:putative scaffold:Myoluc2.0:GL430265:386990:458353:1 gene:ENSMLUG00000009934 transcript:ENSMLUT00000009929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIQEQGFPLDLASFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGVGIKGETSTATP
RRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFAC
TGFRKLEPCDSNEEKRLKLAKAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQLIDPAM
FDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGISGYLPTL
NEDEEWKCDQDIDEDDGRDPAPAGRVTQKLLQETAAPRASSSRRYSEGREFRYGSWREPV
HPYYVNSGYALAPATSTNDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRREMQESVQ
VNGRVPLPHIPRTYRIPKEIRVEPQKFAAELIHRLEAVQRTREAEEKLEERLKRVRMEEE
GEDGDVSSAPPGASHKLPLAPAWHSFPPRYTDVGCTGLRDAHEENPESILDEHVQRVMRT
PGCQSPGPGHRSPDSGHMPKMSGVLGGTTLGHSKHVPKLGAKLEAAGLHLHRHSHHHSHH
GAARPKEQAEAEAIRRVQSSFAWGPELHSHTAKTRSHLESVGTTPSANDSLAYSGKAGTT
SKRNAKKTESGKSASTEVSGPSEDAEKNQKIMQWIIEGEKEISRHRKTGHGSSGAKKQQI
HESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEE
EEKRASKLPSKQRYVQEVIQRGRSCVRPVCTPVLSVVPAVSDTELSETETKPQKKAGGGS
AQLCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVV
FEEVREDEAILPVFEEKIIGKVEKVD
Download sequence
Identical sequences G1PEU8
ENSMLUP00000009052 ENSMLUP00000009052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]