SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009110 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009110
Domain Number 1 Region: 335-461
Classification Level Classification E-value
Superfamily TIMP-like 1.07e-37
Family Netrin-like domain (NTR/C345C module) 0.000000738
Further Details:      
 
Domain Number 2 Region: 159-272
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-35
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 3 Region: 37-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-34
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009110   Gene: ENSMLUG00000009985   Transcript: ENSMLUT00000009992
Sequence length 470
Comment pep:putative scaffold:Myoluc2.0:GL429767:245448:250329:-1 gene:ENSMLUG00000009985 transcript:ENSMLUT00000009992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPAATASLLGLLLPAWTLLPFAQGQTPNYTRPVFLCGGDVTGESGYVASESFPNLYPPN
KECIWTITVPEGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPI
VAPGNQVTLKMTADEGTGGRGFLLWYSGRATSSTEHQFCGGRLEKAQGTLTTPNWPESDY
PPGISCSWHIIAPPNQVISLTFGKFDVEPDTYCRYDSVSVFNGAVSDDAKRLGKFCGDTA
PGPISSEGNELLVQFVSDLSVTADGFSASYRTLPRGAAKEGPAQSPGEDARPGPPLLGPG
PKPGTPPKVKPEPPPAEKPKATPEVQATPVGPNAPSVTCPKQCRRTGTLQSNFCTSNLVV
TATVKSMVRGPGEGLTVTVSLIGVYKTGGLDLPSAPTDTSLKFYVPCKQCPPMKKGASYL
LMGQVEENRGPILPPDSFVVLYRPNQDQILTNLSKRRCPSQPVRAARSQA
Download sequence
Identical sequences G1PEZ5
ENSMLUP00000009110 ENSMLUP00000009110 XP_006081084.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]