SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009184 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009184
Domain Number 1 Region: 648-758
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000412
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 
Domain Number 2 Region: 800-825,909-982
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000854
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 
Domain Number 3 Region: 366-488
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000824
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009184
Domain Number - Region: 89-194
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0549
Family Regulator of G-protein signaling, RGS 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009184   Gene: ENSMLUG00000010082   Transcript: ENSMLUT00000010075
Sequence length 1079
Comment pep:putative scaffold:Myoluc2.0:GL429821:6364685:6397556:1 gene:ENSMLUG00000010082 transcript:ENSMLUT00000010075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPHIEIICSTNLIILLEDEIFADFFNTFLSLPVFGQTPFYTVENAQWSLWPEIPHDLIPK
YKGLLTWLGKYRLPFFCKTNLCFHYILCQELISFINSPEGGEELVDFWILAEKILGIDEM
DLELRDHYLSLLLVLKATHLQEGSRVVTLCNMNIKSLLNLSIWHPNQSTTRREILSNMQK
VALFKLQSYWLPNFHIHAKTIIAKEETCQHLMQEYETRQCSLCCSHLGELPLNMSIKKSC
HPQRRYSSRKIKQKMWQLIDHASWSLELDTKPGDNSTSSQEICPQEKVVVHMPSLKKASS
KEGITSSLEKDSLSARKSNMKKKAKSHLHMEGLFETKISTHLRTATPIIRHSPHLTIKGA
IKKRLSLGYTHWALCADAFAGSPFRDHLKKLNLKMEIQLLDLWQDLHHFLNVLMNNRKTG
NAIFWHILGNRICELYLNEQIGPRLPLKSQTIEGLKELLPSGNMNPWIPKAQEEICQMLS
SWYEEFLNEEDSSFLTYATQTSVNHTRRHKKDAISKQENILLYKRLEESLALSQGLANME
EMDSVQWRKLATEDLRHDGSLRVELKSPVFLTDIEKMSFEELCYKYPKVAIEKISEDYKI
YCKKAPTNYQYKVYRQIITRESRTHSPPPKEASLKKIPVVRKPSHRPRNLAEVFRNVQHL
EYFTEFLKERKAEVPLQFLMALQKISIETDEQVSKSLVENVMETYFSDIVPAEEMLQCDD
PIIREVSRKGRLSTNSMLILQSCVMKSLEEKWFKEYQELFPDFPQEVQAQIRTVYRKPSK
TSSMQIQEPQKRIWPKLVGFVKSFCKYRRCMNNVNLRQEFEKYLHLELNNKENYPASPNV
PARPSPHHSNVRSAEENGDVIFMKRRIFGHRVITVNFALSDLYFFSEMERFNDLVSSAHV
LQVSWAYNENDVILMKSKINIILKLYLQSEVPPRLRVNITESQRDAIISAIAEGRLDRSI
FHGAIVSLFPVIMYFWKRFCSWKVTRSYFQKKERKSRDSKTPSKSVAKYSIWSGGEHAIL
RFSLLRGIEWLRPQQRDAIASSVQNSSSTSNLTQTGHTVSSMQLFPALGKKPSVIKKEK
Download sequence
Identical sequences G1PZH1
ENSMLUP00000016853 ENSMLUP00000009184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]