SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009348 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009348
Domain Number 1 Region: 11-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-44
Family G proteins 0.0000214
Further Details:      
 
Domain Number 2 Region: 190-229
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000798
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009348   Gene: ENSMLUG00000010258   Transcript: ENSMLUT00000010259
Sequence length 282
Comment pep:putative scaffold:Myoluc2.0:GL430265:123081:153878:-1 gene:ENSMLUG00000010258 transcript:ENSMLUT00000010259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLD
GRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGV
PRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVTESFTELSRIVLMRHG
MEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGR
SYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences G1PFJ3
ENSMLUP00000009348 ENSMLUP00000009348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]