SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009446 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009446
Domain Number 1 Region: 31-185,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.15e-64
Family FCH domain 0.0017
Further Details:      
 
Domain Number 2 Region: 514-697
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000919
Further Details:      
 
Domain Number 3 Region: 742-805
Classification Level Classification E-value
Superfamily SH3-domain 4.41e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009446   Gene: ENSMLUG00000010338   Transcript: ENSMLUT00000010363
Sequence length 1099
Comment pep:putative scaffold:Myoluc2.0:GL429775:15722143:15941415:1 gene:ENSMLUG00000010338 transcript:ENSMLUT00000010363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVMKTYHMYHAESISAESK
LKEAEKQEEKQFNKAGELSMNLLRHDDRPQRRSSVKKIEKMKEKRQAKYSENKLKCTKAR
NDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGLD
VIENAVDNLDSRSDKHTVMDMYNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRYH
QLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETYM
SKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERADCGTTRP
PCLPPKPQKMRRPRPLSVCNHKLFNGCMEAFIKDSGQAIPLVVESCIRYINLYGLQQQGI
FRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQDL
ISTIKLESPAERVHQIQQILITLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMHIPDGQDPVSCQAHVNEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSPH
SEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYVGRSPRELSFKKGASLLLYHRASED
WWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPTD
HISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKIP
LTRGRIESPEKRRMATFGSAGSINYSDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEAL
AEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPVSSEPASPLHTIAIRD
PDAAVRRGCSSSAEMMTTFKPALSARLAGAQLRPPPVRPVRPTVQHRSSSSSSSGVGSPA
VTPTEKMFPNSSADKSGTM
Download sequence
Identical sequences G1PFS3
ENSMLUP00000009446 XP_006083962.1.53796 ENSMLUP00000009446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]