SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009463 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009463
Domain Number 1 Region: 9-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.05e-48
Family WD40-repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 1009-1069
Classification Level Classification E-value
Superfamily HMG-box 0.000000279
Family HMG-box 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009463   Gene: ENSMLUG00000010353   Transcript: ENSMLUT00000010382
Sequence length 1128
Comment pep:putative scaffold:Myoluc2.0:GL429958:259446:313264:1 gene:ENSMLUG00000010353 transcript:ENSMLUT00000010382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATQKPMRYGHTEGHTDVCFDDSGSCIVTCGSDGDVRIWEDLDDDDPKSINVGEKAYSC
ALKSGKLVTAVSNNTVQVHTFPEGVPDGILTRFTTNANHVVFNSDGTKIAAGSGDFLVKV
VDVMDCSQQKTFRGHEAPVLSLSFDPKDVFLASASCDGSVRVWQISDQTCAISWPLLQKV
SDVINAKSICRLAWQPKSGKLLAVPVEKSVKLYRRETWNNQFDLSDNFISQTLNVVTWSP
CGQYLAAGSINGSIIVWNVETKECMERVKHEKGYAICGLAWHPTCGRIAYTDAEGNLGLL
ENVCNSNGKIPSSKVSSRVEKDYNDLFDGDDTSNAGDFLNDNTVETPSFSKGIINDDEDD
DIMLASGRPRQRSHFLEDDENSVDITMLKTGSSLLKEKEEDDQAESIYNLPLVTSQPLYD
GPMPTPRQKPFQSGSTPSHLTHRFMMWNSIGIIRCYNDEQDNAIDVEFHDTSIHHATHLS
NTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIVDMPQNEDIEAICLGQ
GWAAAATSALLLRLFSIGGVQKEIFSLPGPVVSMAGHGEQLFIVFHRGTGFDGDQCLGVH
LLQMGKKKQQILHGDPLPLTRKSYLVWVGFSAEGTPCFVDSEGIVRMLNRGLGNTWTPVC
NTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAVLSFQLPYCQVTTEK
GQMEEQFWRSVMFHNHLDYLAKNGYEYEENTKNQAIKEQQELLLKMLALSCKLEREFRCV
ELAELMTQNAVNLAIKYASRSRRLILAQRLSELAVEKAAELAATQVEEEEEEGDFRKQLS
AGYSNTPTEWSQPRLRNQVEEEAEDTGEADDTEETSEVPKHGQNPFSKSANSSDVPAVKK
GAVTSSNAGRVNPFKVSANSKEPAISVNSGRSANILDNMNKSYKKSTALNRATNDEKSPV
IKPLVPKPKSKQASAVSYFQKRTSQADKTEEVKEENPKNSSSETPAMCPQNTENQRPKSG
FQMWLEENRSNILSDNPDFSDEADIIKEGMLRFRVLSTEERKAWTAKAKGGTASDGAEAK
KRKHVADESEETEHQEEKAKENLNLPKKQKPLDLSTNQKLSAFAFKQE
Download sequence
Identical sequences G1PFT7
ENSMLUP00000009463 ENSMLUP00000009463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]