SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009607 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009607
Domain Number 1 Region: 284-412
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-44
Family Regulator of G-protein signaling, RGS 0.00000281
Further Details:      
 
Domain Number 2 Region: 209-271
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000131
Family Transducin (heterotrimeric G protein), gamma chain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009607
Domain Number - Region: 62-115
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000299
Family DEP domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009607   Gene: ENSMLUG00000010526   Transcript: ENSMLUT00000010540
Sequence length 463
Comment pep:putative scaffold:Myoluc2.0:GL430265:472499:480186:1 gene:ENSMLUG00000010526 transcript:ENSMLUT00000010540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPASHGGCPRAQMPHLSKVGAGWGSCRPQDFWHQGREGQRPCSILPDEDVPPALTSQ
PHPEALHLGVLLVLHGYLYALREPRSPGLQLDETLYRFQTPYFWTSTLWPAAELDYAIYL
AKKNIRKQGALVDHEKEHYDQLHRKINHTWDLVVMQAREQLRASKQRRKADRLVIACQEQ
TYWLVNRPPPGVPSVLEQGPERGSCMARRVQVTKNTDFYKQEIECCTKALGRIRVKSSVC
LEAYLKFSSQHGPHDPIMSGCLPSNPWITDDDTYWAMNAPNVAVPTKLRVERWGFSFREL
LEDPVGRAHFMDFLRKEFSAENLSFWEACEELRHGGQAQIPALVDSVYQQFLAPGAARWV
NIDSQTMERTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKGLLAEATILPET
KRRVFPFMWKPRHSSLSPALPPASASVEPAAAAGGPGGGDGEA
Download sequence
Identical sequences G1PG62
ENSMLUP00000009607 ENSMLUP00000009607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]