SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009678 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009678
Domain Number 1 Region: 49-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-32
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 170-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009678   Gene: ENSMLUG00000010614   Transcript: ENSMLUT00000010618
Sequence length 533
Comment pep:putative scaffold:Myoluc2.0:GL429849:1856857:1938037:-1 gene:ENSMLUG00000010614 transcript:ENSMLUT00000010618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYGRSVLRIVASLIILHLSGATKKGTEKQATSETQKSVQCGTWTKHADGGVFTSPNYPS
KYPPDRECIYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGK
QNPPTIKSSGRFLWIKFFADGELESMGFSARYNFTPDPDFKDLGVLKPLPVCEFEMGGPE
GIVESIQIMKEGKASASEAVDCKWYIRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGS
SSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNMFFCH
SNMCINNTLVCNGLQNCVYPWDENHCKEKRKAGLLDQLTNTSGTVIGVTSCIVIILIIIS
VIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGAGATADFADVGDDFDNYHKL
RRSSSKCIHDHHCGSQLSSAKGSRSNLSTRDASVLTEMPPQPVKPLVPPSNRRNILVMKH
NYSQDAADACDIDEIEEVPTTSHRLSRHEKAVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences G1PGC2
XP_006090844.1.53796 XP_014313098.1.53796 ENSMLUP00000009678 ENSMLUP00000009678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]