SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009739 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009739
Domain Number 1 Region: 229-337
Classification Level Classification E-value
Superfamily Cadherin-like 6e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 460-557
Classification Level Classification E-value
Superfamily Cadherin-like 8.57e-18
Family Cadherin 0.0023
Further Details:      
 
Domain Number 3 Region: 142-236
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000485
Family Cadherin 0.0037
Further Details:      
 
Domain Number 4 Region: 338-449
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000614
Family Cadherin 0.0043
Further Details:      
 
Domain Number 5 Region: 560-664
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000642
Family Cadherin 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009739
Domain Number - Region: 27-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.00186
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009739   Gene: ENSMLUG00000010673   Transcript: ENSMLUT00000010683
Sequence length 885
Comment pep:putative scaffold:Myoluc2.0:GL429785:9443328:9498243:-1 gene:ENSMLUG00000010673 transcript:ENSMLUT00000010683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEAVFLLVLLGAMSAGEALHLIHLPATSNVAENSSPGTSVHKFSVKLSASLSPVMPGLP
LIINTSPLTEAFNVNSLSGTEFEVVTTGKEQLDFETGPNMFDLQIYVKDDVGVTDLQILT
VQVTDVNEPPQFPGNLAKGLDLYIVEGANPGFSYQVEAFDPEDTSQNIPLSYFLISPSKS
FSMSANGTLFSTTGFDFEAGHNSYHLTVEVRDSQGLRASTSLRVNIVNINDEIPRFTSPT
RMYVIPEELGPGTVVANITAEDPDNEGLTSFLLYSITTVNSYFMINQLTGTIQVAHRLDR
DAGELRQNPAISLEVLVKDRPFGGQENRMQITFLVKDINDNPATCTKFTFSIMVPERAAK
GTLLLDLNTVCFDDDSEAPNSQFNFTEPSGVGSRRRFLQDPAGSGKIVLIGDLDYENPSN
LAAGNKYTVTTQVQDVAPPYYKNNIYIYVLTSPENEFPLVFDQPSYVFDVSEISPARARI
GRVQAADKDFPQSSTVYSISTGGASLQYPDIFWINPKTGELQLVTKVDYETTPIYILIIQ
ANNHEDTSSVTVTVNVLEENDEKPICIPNSYFLAIPVDLKVGTNIQNFRLMCTDRDSSPR
SFRYSIGPGNVNRHFTFSPNAGSNITHLLLATRFDYPGGLDKIWDYKLLVYITDDNLLSG
RKKVEALVETGTVTLSISVIPPPTTIVTTTPRPRITYQIRRKNVYSPSAWYVPFVITLGS
ILLLVLLVALIVQLAKAIHRHCPCKTGKHKKPLMKKGEMKKTKREVVVDTIRLSTVFDGE
ATDPVTGAKYEFNSKTGARKWKGSLMQMSSWKESSPQGAAASNAVSSGGTGPPRSTDEEG
DGPSGQAQASDAGPGSRNHDGKPGTPKHRDPALKSRASPKPPPGK
Download sequence
Identical sequences G1PGH4
XP_006085449.1.53796 ENSMLUP00000009739 ENSMLUP00000009739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]