SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009782 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009782
Domain Number 1 Region: 287-416
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-44
Family Regulator of G-protein signaling, RGS 0.000000171
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-28
Family DEP domain 0.0078
Further Details:      
 
Domain Number 3 Region: 220-276
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000353
Family Transducin (heterotrimeric G protein), gamma chain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009782   Gene: ENSMLUG00000010715   Transcript: ENSMLUT00000010731
Sequence length 670
Comment pep:putative scaffold:Myoluc2.0:GL429867:2275093:2327959:1 gene:ENSMLUG00000010715 transcript:ENSMLUT00000010731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIRHQGQQYRPRMAFLQKIEALVKDMQSPETGVRMQNQKILVTSIPHAMTGSDVLQWLV
QRLWISSLEAQNLGNFIVKYGYIYPLQDPKNLILKPDGSLYRFQTPYFWPTQQWPAEDTD
YAIYLTKRNIKKKGVLEEHEKENYDFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYAL
DCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVQKQTITAVKKEIMYYQQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLSCQLLVEIPTKMRVERWAIN
FSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGA
RRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIE
PQETTKRSSSLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHTAPSPHLAV
YTGTCVPPSPSSPFSSSCRSPRKPFPSPGRFMRRPSSTVCPSPITVAVEGSEQKGEAGGS
SAGPGPSNADTSEASADCPWPRPPPRAPLKARMAVSFNSFLRRGCLASPVFARLSPRCPP
VSHGKVQPLGDVGQQLPRLKSRRVTNFFQIKMDVPVESGTYLMDAEDTGPGASGDQAIKK
EVICPWESLA
Download sequence
Identical sequences G1PGL5
ENSMLUP00000009782 ENSMLUP00000009782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]