SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Myotis lucifugus 69_2.0 > ENSMLUP00000010089

Domain assignment for ENSMLUP00000010089 from Myotis lucifugus 69_2.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMLUP00000010089
Domain Number 1	Region: 18-253
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	5.32e-58
Family	Ankyrin repeat	0.0000798
Further Details:

Domain Number 2	Region: 269-313
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.000000107
Family	SOCS box-like	0.0046
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMLUP00000010089 Gene: ENSMLUG00000011079 Transcript: ENSMLUT00000011070
Sequence length	318
Comment	pep:putative scaffold:Myoluc2.0:GL430292:143176:162585:-1 gene:ENSMLUG00000011079 transcript:ENSMLUT00000011070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKE RCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTP LHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHSANIDIQN GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCARMLYSYGADT NTRNYEGQTPLAVSLSISGSGRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDD LPIAKVIKDYLKHKFDGI
Download sequence
Identical sequences	G1PHE0 L5LCW7 S7PIQ2 ENSMLUP00000010089 ENSMLUP00000010089 XP_006771804.1.95426 XP_014301826.1.53796 XP_014399093.1.60319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]