SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010221 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010221
Domain Number 1 Region: 171-370
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.39e-56
Family Prokaryotic proteases 0.000000702
Further Details:      
 
Domain Number 2 Region: 382-478
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-20
Family HtrA-like serine proteases 0.001
Further Details:      
 
Domain Number 3 Region: 39-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010221   Gene: ENSMLUG00000011220   Transcript: ENSMLUT00000011218
Sequence length 481
Comment pep:putative scaffold:Myoluc2.0:GL429793:8738641:8749092:1 gene:ENSMLUG00000011220 transcript:ENSMLUT00000011218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPSLQPAGLGQFLLLWLLLLPPVPDPRVEAQRTWPSPFCPAVCEPMRCPPLPTCPSGATP
VQDRCRCCRVCPAAEGEVCGGALGRPCAPGLQCSAPFRRGAWVALGGAPAAALADGAAAH
PYASGTTGYRTGETEERKGKEEDQEARVPSPPVMEHFFTGTRSAGWLRSNYNFIAEVVEK
VAPSVVHLQLFRRSPLNGKDIPVSSGSGFIVSEDGLIVTNAHVLTNRQRIQAELQSGVQY
EATVKDIDHKLDLALIKIEPNTDLPVLLLGKSSDLRAGEFVVALGSPFSLQNTVTAGIVS
TTQRGGKELGLEDSDMDYIQTDAIINHGNSGGPLVNLDGDVIGINTLKVTAGISFAIPSD
RIREFLAEFHERQLKGKALAQRKYLGLRMLPLTMNLLREMKRQDPDFPVVSSGVFVYEVI
QGTAAESSGLRDHDVIVSINGQPVTTTTDVAEAVKDNDSLSMVVRRGSQTLILTITPEII
D
Download sequence
Identical sequences G1PHR3
ENSMLUP00000010221 ENSMLUP00000010221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]