SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010799 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010799
Domain Number 1 Region: 4447-4573
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.57e-23
Family HEPN domain 0.005
Further Details:      
 
Domain Number 2 Region: 87-287
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.5e-22
Family Heat shock protein 90, HSP90, N-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 1449-1638
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.31e-18
Family Heat shock protein 90, HSP90, N-terminal domain 0.046
Further Details:      
 
Domain Number 4 Region: 2517-2701
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.8e-16
Family Heat shock protein 90, HSP90, N-terminal domain 0.06
Further Details:      
 
Domain Number 5 Region: 4303-4368
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000458
Family Chaperone J-domain 0.0000244
Further Details:      
 
Domain Number 6 Region: 6-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000839
Family Ubiquitin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010799   Gene: ENSMLUG00000011827   Transcript: ENSMLUT00000011854
Sequence length 4577
Comment pep:putative scaffold:Myoluc2.0:GL429774:15837154:15894543:1 gene:ENSMLUG00000011827 transcript:ENSMLUT00000011854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLSHRRLRVTVLPGCVGCRTVAALESWTARDVKESIAAETGFPVSEQRLWLGDRELPDWI
KIGELTSKNCHLFVNLQSKGLKGGGRFGQTTPPLVDFLKDILRRYPEGGQILKELIQNAE
DAGATEVKFLYDETQYGTETLWSKDMAQYQGSALYVYNNAVFTPEDWHGIQEIARSRKKD
DPLKVGRFGIGFNSVYHITDVPCIFSGDQIGMLDPHQTLFGPHESGQCWNLKDDSEEISE
LSDQFAPFIGIFGSSKETFINGHFPGTFFRFPLRLQPSQLSSNLYNKQKVLELFESFRAD
ADTVLLFLKSVQDVSLHVREADGTEKLVFKVTASENKALKQERPNSVKILETAISNYCKK
IPSNSITCVTYHINIVLEDESTKDTQKTSWLVCNSVGGRGMSSKLDSLADELKFVPTIGI
AMSLSNRDDEEKGATFDFSGKAFCFLPLPPGEESKTGLPVHISGFFGLTDNRRSIKWREL
DQWRDPAALWNEFLIMNVVPKAYATLILDSIKRLESKKSSDLPLSVDIIYKLWPDVNKVK
VHWQPVLEPLFSELFQNAVIYSISNHWVKLEQAYFSELDESLEHTKTVLNYLHSSGKQIV
KVPANLAAAVQLTVSSEKPVRKVTPAWVRQVLRKSVHLGSAEEKLHLLEFVLSDQAYSEL
LGLELLPLQNGNFIPFSSSVSDQDVIYITSEDYPRSLFPGLEGRFILDNLKPHLLAALKE
AAQTRGRPCTQLQLLNPERFARLIKEVMNTFWPGRELIVQWYPFDEDKNHPSVSWLKMVW
RNLYIHFSEDLTLFDEMPLIPRTTLEEGQTCVELIRLRIPSLVILDDESEAQLPEFLADI
VQKLGGIVLKKLDAFIKHPLVKNYIHSPLPSAVLQIMEKMPLQKLCNQIASLLPTHKDAL
RKFLATLTDSSEKEKRIIQELAIFKRINNSSGQGISSYTKLKGCKVLHHTAKLPPDLRLS
ISVIDSNDEATIRLANMLKIETLKTSSCLKLVLKDIENGFYSHVEITHLMLWILENLSSL
KNENPNVLDWLMPLKFIQISQERMVSASELFDPDIEVLKDLFYSEEETCFPPSVFTSPDI
LHSLRQIGLKNEASLKEKDVVQVAKKIEALQVSACPNQEVLTKKAKTLLLVLNKNHTLLQ
SSEGMMTLKKIKWVPACKKRPPNYPGSLVWKGDLCSLCAPPDMCDAAHAILVGSALPLVE
SIHVNLEKALGIFTKPSISAVLKHFKIVVEWYTSKTFSDEDYYQFQHILLEIYGFMHDHL
NEGKDAFRALKFPWVWTGKKFCPLAQAVIKPFHDLDLQPYLHNVPKTMAKFHQLFKVCGS
IEELTSDHISMVIQKVYLKSDQDLSEQESKQNLHLMLNIIRWLYSNQIPVSPNTPVPIHH
NRNPSKLIMKSIHECCYCDIKVDDLNDLLEDSVEPIILVHEDIPMKTAEWLKVPCLSTRL
INPENMGFEQSGQREPLTVRIKNILEEYPSVSDIFKELLQNADDANATECSFMIDMRRNM
DIRENLLDPGMAACHGPALWSFNNSEFSDSDFVNITRLGESLKRGEVDKVGKFGLGFNSV
YHITDIPIIMSREFMIMFDPNINHISKHIKDRSNPGIKINWSKQQKRLRKFPNQFKPFID
VFGCQLPLTVETPYSYSGTLFRLSFRTQQEAKVSEVSNACYNTADIYSLVDEFSLCGHRL
IIFTQSVNSMYLKYLKIEESNPSLAQDTVIIKKKICSSKALNTPILSVLKEAAELMKTCS
GSNKKPPTDAPKSSCILQITVEEFHHVFRRIADLHSPLFRGPDDDPAALFEMAKSGQSKK
QSDELSQKTVECTTWLICTCMDTGEALKFSLNESGRRLGLVPCGAVGVLLSEVQDQKWAV
KPHVGEVFCYLPLRIKTGLPVHINGCFAVTSNRKEIWKTDTKGRWNTTFMRHVIVKAYLE
ALSVLRDLATSGELMDYTYYAVWPDPDLVHDDFSVICQGFYEDIAHGKGKELTRVFSDGS
MWVSMKNVRFLDDSILKRRDVGPAAFKIFLKYLKKTGSKNLCAVELPSSVKLGFEEAGCK
QILLENTFSEKQFFSEVFFPNIQEIEAELRDPLMNFVLNEKIDEFSGILRVTPCIPCSLE
GHPLVLPSRLIHPEGRVAKLFDTKDGRFPYGSTQDYLNPIILIKLVQLGMAKDDILWDDM
LERTESVTEINKSDHAAACLRSSILLSLIDEKLKIRDPRAKDFAAKYQTIPFLPFLTKPA
GFSLDWKGNSFKPETMFAATDLYTAEHQDIVCLLQPILNENSHSFRGCGSVPLAVKEFLG
LLRKPTVDLVVNQLKEVAKSVNDGITLYQENITNACYKYLHEAMMQNEITKLSIVEKLKT
FSFILVENAYVDSEKVSFHLNFEAAPYLYQLPNKYKNNFRELFESVGVRQSFTVEDFALV
LESIDQKRGTKQITEETFQLCRRIISEGIWSVIREKKQEFCEKKYGKILLPDTNLKLLPA
KSLCYNDCPWIKVKDTTVKYCHADIPREVAVKLGAVPKRHKALERYASNICFTTLGSEFG
QKEKLTSRIKSILNAYPSEKEMLKELLQNADDAKATEICFVFDPRQHPVDRIFDDKWAPL
QGPALCVYNNQPFTDDDVRGIQNLGKGTKEGNPYKTGQYGIGFNSVYHITDCPSFISGND
ILCIFDPHARYAPGATSISPGRMFRDLDADFRTQFSDVLDLYLGTHFKLDNCTMFRFPLR
NAEMAKISEISSVPSSDRMVQNLLDKLRSDGAELLMFLNHMEKISICEIDKTTGALNVLY
SVKGKITDGDRLKRKQFHASVIDSVTKKRQLKDIPVQQITYTMDTEDSEGNLTTWLICNR
SGFSSMEKVSKSVISAHKNQDITLFPRGGVAACITHNYKKPHRAFCFLPLSLETGLPFHM
NGHFALDSARRNLWRDDNGVGVRSDWNNSLMTALIAPAYVELLIQLKKRYFPGSDPTLSV
LQNTPIHVVKDTLKKFLSFFPVNRLDLQPDLYCLVKALYSCIHEDMKRLLPVVRAPNIDG
SDLHSAVIITWINMSTSNKTRPFFDNLLQDELQHLKNADYNITTRKTVAENVYRLKHLLL
EIGFNLVYNCDETANLFHCLVDADIPVSYVTPADVRSFLMTFSSPDTNCHIGKLPCRLQQ
TNLKLFHSLKLLVDYCFKDAEENEMEVEGLPLLITLDSVLQTFDAKRPKFLTTYHELIPS
RKDLFMNTLYLKYGNILLNCKVAKVFDISSFADLLSSVLPREYKTKNCTKWKDNFASESW
LKNAWHFISESVNVKEEQEETKPTFDIVVDILKDWALLPGTKFTVSANQLVVPEGDVLLP
LSLMHIAVFPNAQSDKVFHALMKAGCIQLALNKICSKDSTFVPLLSCHTANIESPTSILR
AVHYMVQTSTFRAEKLVENDFEALLMYFNCNLSHLMSQDDVKILKSLPCYKSISGRYMSI
AKFGTCYVLTKSIPSAEVEKWTQSSSSAFLEEKIHLKELYEVLGCVPVDDLEVYLKHLLP
RIENLSYDAKLEHLIYLKNRLSNIEELSEIKEQLFEKLESLLIIYDANSRLKQAKHFYDR
TVRVFEVMLPENLFIPKDFFKKLEQLIKPKNQVAFMTSWVEFLRNIGLKYMLSQQQLLQF
AKEISVRANTENWSKETLQNTVDILLHHIFQERIDLLSGNFLKELSLIPFLCPERAPAEF
IRFHPQYQEVNGTLPLIKFSGAQVNPKFKQCDVLQLLWTSCPILPEKATPLSIKEQEGSD
LGPQEQLEQVLSMLNVNLDPPLDKVINNCRNICNITTLDEEMVKTRAKVLRSIYEFLSTE
KREFRFQLRGVAFVMVEDGWKLLKPEEVVINLEYESDFKPYLYKLPLELGTFHQLFKHLG
TEDIISTKQYVEVLSRIFKSSEGKQLDPNEMRTVKRVVSGLFKSLQNDSVKVRSDLENVR
DLALYLPSQDGRLVKSSILVFDDAPHYKSRIQGNIGVQMLVDLSQCYLGKDHGFHTKLIM
LFPQKLRPRLLSSILEEQLDEETPKVCQFGALCSLQGRLQLLLSSEQFITGLIRIMKHEN
DNAFLANEEKAIRLCKALREGLKVSCFEKLQTTLRVKGFNPIPHSKSETFAFLKRFGNAV
ILLYIQHSDSKDINFLLALAMTLKSATDNLISDTSYLIAMLGCNDIYRISEKLDSLGVKY
DSSEPSKLELPMPGTPIPAEIHYTLLMDPMNVFYPGEYVGYLVDAEGGDIYGSYQPTYTY
AIIVQEVEREDADNSSFLGKIYQIDIGYSEYKIVSSLDLYKFSRPEESSQSRDSAPSTPT
SPTEFLAPGVRNIPPLFSGKESHKTSSSKHHSPKKLKVNSLPEILKEVTTVVEQAWKLPE
SERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEINRLEKQAFVDQNTDRASRRTFST
SAARFQSDKYSFQRFYTSWNQEATSHKSERQQQNKEKCPPSAGQTYSQRFFVPPTFKSVG
NPVEARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKP
TALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVME
CTACIIIKLENFIQQKV
Download sequence
Identical sequences G1PJ81
ENSMLUP00000010799 ENSMLUP00000010799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]