SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011009 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011009
Domain Number 1 Region: 384-702
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.88e-87
Family p120GAP domain-like 0.0000787
Further Details:      
 
Domain Number 2 Region: 253-367
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000027
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 
Domain Number 3 Region: 204-255
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000134
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011009
Domain Number - Region: 1061-1154
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011009   Gene: ENSMLUG00000012071   Transcript: ENSMLUT00000012083
Sequence length 1233
Comment pep:putative scaffold:Myoluc2.0:GL430454:123718:149860:-1 gene:ENSMLUG00000012071 transcript:ENSMLUT00000012083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVRGPPMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLDEDEIHPLLIRDRRSDSSRNKLL
RRTVSVPVEGRPHGEHATPPQLPSALSFPPEHHLGRSRRKSVPGGKQYSMEAAPAAPFRP
SQGFLSRRLKSSIKRTKSQPKLDRTSSFRQILPRFRSADHDRARLMQSFKESHSHESLLS
PSSAAEALELNLDEDSIIKPVHSSILGQEFCFEVTTSSGTKCFACRSAAERDKWIENLQR
AVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFW
GEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLP
TGGKGKGGCPAVRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVA
SALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKD
AIGEFIRALYESEENCEVDPIKCTASSLAEHQANLRMCCELALCKVVNSHCVFPRELKEV
FASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYPDEQTSRTLTLIAK
VIQNLANFSKFTSKEDFLGFMNEFLELEWGSMQQFLYEISNLDTLTNSSSFEGYIDLGRE
LSTLHALLWEVLPQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPSRQSERPRPQPVVL
RGPSAEMQGYMMRDLNSSMDMARLPSPTKEKPPPPPPGGGKDLFYVSRPPLARSSPAYCT
SSSDITEPEQKMLSVNKSVSMLDLQGDGPGGRLNSSSVSNLAAVGDLLHSSQASLTAALG
LRPAPAGRLSQGSGSSITAAGMRLSQMGVTTDGVPAQQLRIPLSFQNPLFHMAADGPGPP
GKSEDLSSGVPKPPAASILHSHSYSDEFGPSGTDFTRRQLSLQDNLQHMLSPPQITIGPQ
RPAPSGPGGGSGGGGSGGGGGGQPPPLQRGKSQQLTVSAAQKPRPSSGNLLQSPEPSYGP
ARPRQQSLSKHSQTPSTLNPTMPASERTVAWVSNMPHLSADIESAHIEREEYKLKVKEYE
EEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQVEKDSQI
KSIIGRLMLVEEELRRDHPTMAEPLPEHQEEAARRSVRALLFGVLQERQLPPLGPTNPRV
TLAPPWNGLAPPVPPPPPRLQITENGEFRNTAD
Download sequence
Identical sequences G1PJR9
ENSMLUP00000011009 ENSMLUP00000011009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]