SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011268 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011268
Domain Number 1 Region: 164-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.83e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 610-669
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 3 Region: 443-500,528-536
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.79e-16
Family TB module/8-cys domain 0.00031
Further Details:      
 
Domain Number 4 Region: 48-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 332-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000039
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 6 Region: 508-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 552-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 1-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 9 Region: 285-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011268
Domain Number - Region: 379-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0305
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011268   Gene: ENSMLUG00000012310   Transcript: ENSMLUT00000012376
Sequence length 782
Comment pep:putative scaffold:Myoluc2.0:GL432102:174:9024:1 gene:ENSMLUG00000012310 transcript:ENSMLUT00000012376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDECRHPGTCPDGRCVNSPGSYSCLACEEGYRGLSGSCVDVNECLTPGICAHGRCYNLE
GSFRCSCEQGYEVTSDEKSCQDVNECASRASCPTGLCLNTEGSFACSACESGYWVNEEGT
ACEDLDECAFPGVCPSGVCTNTAGSFSCRDCDQGFRPSPRGHTCEDVDECEDLQSNCRGG
ECKNTAGSYQCLCPPGFQLANGTVCEDVDECVGEEYCAPHGECLNSHGSFFCLCAPGFVS
AEGGTRCQDVDECAVTDRCLGGHCVNTEGSFDCLCETGFQPSPESGECVDIDECEDHGDP
VCGAWRCENNPGSYRCVLGCQPGFHLAPSGDCIDIDECANDTVCGSHGFCDNTEGSFRCL
CDQGFETSSSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGHCRPR
GAAGQSIPKAPPGDHLSGPVRMECYSGHKDQPPCSRLLGRNTTQAECCCTQGASWGDACD
LCPAEDSVEFSEICPSGKGYIPVEGAWMFGQTTYTDADECVMFGPGLCQNGRCLNTVPGY
ICLCNPGYHYDATRRKCEDHDECQDMACENGECVNTEGSFHCFCSPPLTLDLSQQRCVNS
TSDMEDLPDHDIHMDICWKKVTNYVCSQPLHGRRTTYTECCCQDGEAWSQQCALCPPTSS
EVYAQLCNVARIEAEREAGVHFRPGYEYGPGSEDLHYSLYGPDGAPFYNYLGPEDAIPEP
PFPNTAGHPGDHVPGLESPLQPSELQPRYVASHPGLCYCNGEEVGTSIASLPSPPPANRC
HQ
Download sequence
Identical sequences G1PKE9
ENSMLUP00000011268 ENSMLUP00000011268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]