SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011428 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011428
Domain Number 1 Region: 2-164,191-315
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.51e-63
Family FCH domain 0.0018
Further Details:      
 
Domain Number 2 Region: 464-649
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.65e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000844
Further Details:      
 
Domain Number 3 Region: 701-759
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000122
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011428   Gene: ENSMLUG00000012552   Transcript: ENSMLUT00000012560
Sequence length 1034
Comment pep:putative scaffold:Myoluc2.0:GL429956:517372:655399:1 gene:ENSMLUG00000012552 transcript:ENSMLUT00000012560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIETEYSRNLEKLAERFMAKTRSTK
DHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDIYLNNVIMRFMQISEDSTRMFKK
SKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAESKLKEAEKQEEKQIGRSGDPVFH
IRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKARNEYLLTLEATNASVFKYYIHDL
SDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLDIIENAVDNLEPRNDKQRFMEMY
PAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQQLQSRLATLKIENEEVKKTTEA
TLQTIQDMVTIEDYDVSECFQHSRSTESVRSTVSETYLSKPSIAKRRANQQETEQFYFMK
LREYLEGSNLITKLQAKHDLLQRTLGEGQKEHQCNLNRGRRNSHARHQDSGQIIPLIVES
CIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFR
GLENPLFPKERFNDLISCIRVDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYS
DENMMDPYNLAICFGPTLMPVPEIQDQVSCQAHVNEIVKTIIIHHETIFPDAKELDGPVY
EKCMAGDDYCDSPYSEHGTLEEVDQDAGTETHTSEDECEPIEAIAKFDYVGRSARELSFK
KGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTE
DKSSSKDMNSPTDRHSDGYLASITQCGRRPGRTSDGHCPLHPPHALSNSSVDLGSPNLAS
HPRGLLQNRGLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYSGFNDHK
PLDPEMIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSP
LHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGP
APPSQGPTDKSCTM
Download sequence
Identical sequences G1PKS8
ENSMLUP00000011428 ENSMLUP00000011428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]