SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011489 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011489
Domain Number 1 Region: 11-128,177-211,240-279
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.14e-20
Family DNA gyrase/MutL, N-terminal domain 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011489
Domain Number - Region: 669-778
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.00235
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 
Domain Number - Region: 829-869
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0157
Family Moesin tail domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011489   Gene: ENSMLUG00000012614   Transcript: ENSMLUT00000012623
Sequence length 928
Comment pep:putative scaffold:Myoluc2.0:GL430151:79174:110334:1 gene:ENSMLUG00000012614 transcript:ENSMLUT00000012623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINKHICLTFTDNGNGMT
SDKLHKMLSFGFSDKVTVNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGETMSVGLLSQT
YLEAIQAEHVVVPIVAFNQHDIRQMINLAESEASLAAILKHSLFPTEQSLLAELDAIIGK
KGTRIIIWNLRSYKSATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSL
RAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIEHDVYRPKFLTKTVKITFGFNCKNKE
HYGIMMYHKNRLIKAYEKVGYQLKANNMGVGVVGIIECNFLKPTHNKQDFDYTNEYRLTI
LALGDKLNDYWNEMKVKKNAEYPLNLPVEDIQKRPDQTWVQCDSCLKWRKLPDGIDHLPE
KWYCSNNPDPQFRNCDVPEEPEDEDLVHPTYEKTYKKRDKDKYRIRQLERLPQINTELLF
STIPLQSISPVKDTVPRGHLSEAANTYAARLVNNRGSPQSEPESNSMKRRLPIRSSILNA
KTPRLSNQAFENPASREDDEDVIILEENSTPKPAIDHQSVEMKPEQSHIEQSMGDMLQDE
PMGDSEPCDQTSSTGTLPSRCDQATAVATQTEVPGVVVKKEETIEDDINTRNDTAALPSC
VEAEGKPQEMQETFDKAVGDAGCRVNELRNELLLVTQEKEDYKRQCHMFTDQIRQLQQRI
LEMNDKYVKKETCHQSTETDAVYLLESINGKSESLDHVASQYRQALDEIERLKKQCSASQ
HVKHECSQCSNSESKSEMDEMVMQLDDVFRQLDKCTVERDQYKSEVELLQIEKSQIRSQC
EELKTEIEQLKSASQQRGTDVSTSSNIEESVNYADGESFKLRSLRVNVGQLLAMIVPDLD
LQQVNYDVDVVDEILGQVVEQMSEISSS
Download sequence
Identical sequences G1PKY0
ENSMLUP00000011489 ENSMLUP00000011489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]