SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011752 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011752
Domain Number 1 Region: 193-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-17
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 399-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 138-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 35-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000654
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011752
Domain Number - Region: 330-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00017
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 356-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00497
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011752   Gene: ENSMLUG00000012915   Transcript: ENSMLUT00000012919
Sequence length 720
Comment pep:putative scaffold:Myoluc2.0:GL430064:629170:634063:-1 gene:ENSMLUG00000012915 transcript:ENSMLUT00000012919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATPSLPFPALPLGGALAHPDRILFPNPACEDPPAVLLEIQGTLQRPLSRDSHSSPANCTW
LIPGSKDQTVMVRFQKLHLACGSERLILRSPLQPQISLCEAPASPLQLPGGNVTITYSYA
GARAPMGQGFLLSYSQDWLICLQEEFQCLNHRCVPSAQHCDGIDSCGDGSDEAGCGSDPF
PDLIPASARTPRCNHTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTAL
DLGYEDAVHVYDGSGPPETSRRLRRLTHFNNGKAVTVETLSGQAIVAYHTVPWSSGRGFN
ATYHVQGYCLPWDQPCGLGSGLGASEGLGERCYSEAQRCDGSWDCADGTDEENCPSCPPG
HYPCGAFGTPSATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCD
GQPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAP
LSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPG
GASGARRRQRGRTVRRLVRRLRRWGLLPRTNPPARTPETRPQVTPSDAPLEALDGSTGPA
REIGAVGGQDGEQAPPLPVKAPLPSASIPPALPTVLEAPGPLPSVPLEPSLLSGVVQALR
GRLLPSLRPPGPIRPPGPTQTPPEPHTIVLSPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences G1PLL2
ENSMLUP00000011752 ENSMLUP00000011752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]