SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012069 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012069
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.42e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012069   Gene: ENSMLUG00000013264   Transcript: ENSMLUT00000013266
Sequence length 413
Comment pep:putative scaffold:Myoluc2.0:GL430985:39200:47472:1 gene:ENSMLUG00000013264 transcript:ENSMLUT00000013266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRTRKVLKEVRVQEDNNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFRQFLASQEDYDPCWSLQDKYNSKAAALFRDKVAALAE
GREWSLESSPAQNWTPPQSKTLPSTAYRASGQPQSSTASSDKAFEDWLNEDLSSYQGAPE
SRYVGFGNTVPPPKKEDDFLNSAMSSLYSGWSSLTTGASRFASAAKEGATRFGSQATQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGRAED
PSDRPLEDQSYQNSGGDNSQNSAIDQSFWEAFGSTDPAKAHRSPSSDSWTCADASAEKRS
SDSWDVWGSASTSNHNSDGGEAWGGGGEGRPKTTRKAAPKAAQVDEGWDNHNW
Download sequence
Identical sequences G1PME4
ENSMLUP00000012069 XP_006107584.1.53796 ENSMLUP00000012069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]