SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012090 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012090
Domain Number 1 Region: 20-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-30
Family Nuclear receptor 0.00014
Further Details:      
 
Domain Number 2 Region: 238-347
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.7e-27
Family Nuclear receptor ligand-binding domain 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012090   Gene: ENSMLUG00000013283   Transcript: ENSMLUT00000013288
Sequence length 349
Comment pep:putative scaffold:Myoluc2.0:GL431675:1102:29773:1 gene:ENSMLUG00000013283 transcript:ENSMLUT00000013288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIE
NQSCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKA
LIRANGLKLEAMSQVIQAMPPELSITSAIQNMHSASKGLPLSHAALPPTDYDRSPFVTSP
ISMAMPPPHGGSLQGYPPYGPFPSRAIKSEYPDPYTSSPESLMGYPYLDGYQTGSPASVP
HLILELLKCEPDEPQVQARIMAYLQQEQAARGKAEKLSTFGLMCKMADQTLFSIVEWARS
SVFFRELKVDDQMKLLQNCWSELLILDHLFRQVVHGKDGCIALVTGQQV
Download sequence
Identical sequences G1PMG2
ENSMLUP00000012090 ENSMLUP00000012090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]