SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012140 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012140
Domain Number 1 Region: 293-548
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.21e-110
Family Hsp90 middle domain 0.0000000107
Further Details:      
 
Domain Number 2 Region: 17-225
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.92e-74
Family Heat shock protein 90, HSP90, N-terminal domain 0.0000000081
Further Details:      
 
Domain Number 3 Region: 571-676
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 3.27e-33
Family HSP90 C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012140   Gene: ENSMLUG00000013341   Transcript: ENSMLUT00000013344
Sequence length 716
Comment pep:putative scaffold:Myoluc2.0:GL430083:1296224:1300693:1 gene:ENSMLUG00000013341 transcript:ENSMLUT00000013344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEETQTHDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDVGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEE
KEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTR
NPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKN
NIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKK
CLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKD
YCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGK
TLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCI
VTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAETALLSSGF
SLEDPQTHANRIYRMIKLGLGIDEDDPTADESSAAVTEEMPPLEGDDDTSRMEEVD
Download sequence
Identical sequences G1PMK8
ENSMLUP00000012140 ENSMLUP00000012140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]