SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012284 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012284
Domain Number 1 Region: 132-207
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000513
Family PDZ domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012284   Gene: ENSMLUG00000013501   Transcript: ENSMLUT00000013500
Sequence length 222
Comment pep:putative scaffold:Myoluc2.0:GL430278:558791:567543:-1 gene:ENSMLUG00000013501 transcript:ENSMLUT00000013500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKEGGSGGASPQASAVTVSDVQELIRRKEEIEAQIKANYGVLESLKGVGMNEPLVDCE
GYPRSDVDLYQVRTARHNIVCLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAQEEAM
SRSLSQSEGLSPPQAFAKVNSVSPGSPASIAGLQVDDEIVEFGSVNTQNFQSLQNIGTVV
QHSEGKPLNVTVIRRGEKHRLRLVPTRWAGKGLLGCNIIPLQ
Download sequence
Identical sequences G1PMY9
ENSMLUP00000012284 ENSMLUP00000012284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]