SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012617 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012617
Domain Number 1 Region: 278-431
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.63e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000551
Further Details:      
 
Domain Number 2 Region: 434-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.26e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000175
Further Details:      
 
Domain Number 3 Region: 148-269
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.0000201
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 645-797
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-28
Family MAM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012617   Gene: ENSMLUG00000013862   Transcript: ENSMLUT00000013868
Sequence length 929
Comment pep:putative scaffold:Myoluc2.0:GL429770:9623818:9740250:1 gene:ENSMLUG00000013862 transcript:ENSMLUT00000013868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFPLTWVFLALYFSGRGVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIVLQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHAYPVGPLIGKYCGTKTPSE
LRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASS
TYSDGRWRPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYY
VKSYKLEVSTNGEDWMVYRHGKNHKVFQGNSDPTEVVLNRLHTPLLTRFVRVRPQTWHAG
IALRLELFGCRVTDAPCSNMLGMLSGLITDAQISASSTREYLWSPSAARLVSSRSGWFPR
IPQAQPGEEWLQVDLGAPKTVKGVIVQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEY
IQDPRTQQPKLFEGNMHYDTPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDA
KPTVETLGPTVRSEETTTPYPIDEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEACGW
IYDHAKWLRSTWAGSTSPNDRTFPDDRNFLRLQSDGRREGQYARLISPPVHLPQSPVCME
FQYQATGGRGVALQVVREASQESKLLWVIREDQGSEWKHGRIILPSYDMEYQIVFEGVIG
KGRSGEIAIDDIRISTDVPLENCMEPISAFAVDIPEVHGREGYEDEIVDEYEVDWSNASS
STSGSSTPSADKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSC
TTLENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences G1PNS5
ENSMLUP00000012617 ENSMLUP00000012617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]