SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012863 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012863
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000351
Further Details:      
 
Domain Number 2 Region: 80-199
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-21
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012863   Gene: ENSMLUG00000014137   Transcript: ENSMLUT00000014141
Sequence length 475
Comment pep:putative scaffold:Myoluc2.0:GL429799:4988347:5638943:-1 gene:ENSMLUG00000014137 transcript:ENSMLUT00000014141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHVLNDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRKIEFYKES
KQQALPNMKTGHKPESVDLCGAHIEWTKEKSSRKNVFQITTASGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDPSTPSRNLELFKIQRSSSTDLLSHYDNDIKEQKPEHRKSLMFRLHH
SASDTNDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPRFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPFSFFERFVEAIKKQDNNTRIETMKSLVQKLPPSNRDTMKVLFGHLTKIVDKA
SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYKKIFGSEED
Download sequence
Identical sequences G1PPD6
ENSMLUP00000012863 ENSMLUP00000012863 XP_006086937.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]