SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012976 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012976
Domain Number 1 Region: 26-190,218-342
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.88e-56
Family FCH domain 0.0035
Further Details:      
 
Domain Number 2 Region: 505-697
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 749-807
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-16
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012976   Gene: ENSMLUG00000014257   Transcript: ENSMLUT00000014266
Sequence length 947
Comment pep:putative scaffold:Myoluc2.0:GL429807:596582:618745:1 gene:ENSMLUG00000014257 transcript:ENSMLUT00000014266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGKLRRERGLQAEYETQIKEMRSQLSEQLRCLELQGELRRELLQELSEFMRRRAEVE
LEYSRGLDKLAERFSSRGGRLGGSSREYQSFRKEPTLLSSLHCWAVLLQQTRQQSRDSAA
LSEVLAGPLVQRLSHIAEDVGRIVKKSKDLEQQLQEELLEVVSELQTAKKTYQVYHTESM
NAEAKLREAERQEEKRAGRSAAPATATTPTEAGPLRKTSVKKGSRVVEKRQAKFLEHKLK
CTKARNEYLLSLASVNAAVSNYYLYDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQASQ
MQGLGSLEEAVEALDPPGDKAKVLEVHSVAFCPPQRFDYQPHEGDEVAEIQVEVELRDEI
LPRAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVALEDGDMLDSFQACPSTESLKSTS
SDPGARQAGRRRGQQQETETFYITKLQEYLSGRSILAKLQAKHEKLQEAIQRGDKEEQEA
PCAQHTQRKFQKSRHPRPSSQYHHKLFGGDMEKFIQSSGQPVPLVVESCVRFINLNGLQH
EGIFRVSGAQLRISEIRDAFERGEDPLVEGCSACDLDSVAGVLKLYFRSLEPPLFPPDLF
RELLASAELEAMEERVELVSRLLTQLPGPVLVVLRYLFTFLSHLAQYSDENMMDPYNLAV
CFGPTLLPVPPGQDPVALQGQVNQLVQTLIVQPARVFPPLTLLPGPVYEKCMAPPSASCL
GDTQVEGLAGENEPELEAGTPAQEDVLEGVVEAVACFSYTGRTAKELTFQRGDVLRLHER
ASDDWWRGEHAGTCGLIPHKYITLPEGAEKQAVGPELQAGELLSSAEGLPAVEITQRPEL
CTPPGGSFGHRRHCLVPSSPDRHVEMDKAVAQTMDSVFKELLGKTTVRQGLGPASTNSPS
PGPRSPKLLGYGRLGKNKGFSRSPGAPASPSSSSSQPPGLDSPLKPH
Download sequence
Identical sequences G1PPM7
XP_006087743.1.53796 ENSMLUP00000012976 ENSMLUP00000012976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]