SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013049 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013049
Domain Number 1 Region: 16-202
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-46
Family DNA gyrase/MutL, N-terminal domain 0.0000341
Further Details:      
 
Domain Number 2 Region: 191-337
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-24
Family DNA gyrase/MutL, second domain 0.0006
Further Details:      
 
Domain Number 3 Region: 567-638
Classification Level Classification E-value
Superfamily HMG-box 1.7e-17
Family HMG-box 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013049   Gene: ENSMLUG00000014340   Transcript: ENSMLUT00000014344
Sequence length 927
Comment pep:putative scaffold:Myoluc2.0:GL430001:220050:282838:-1 gene:ENSMLUG00000014340 transcript:ENSMLUT00000014344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSIDVKLENYGFDKIEVRDNGEG
IKATDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCVAEVLITTRTAADNFSTQ
YVLDGSGHIISQKPSHLGQGTTVTALRLFKNLPVRKQFYSTTKKCKDEIKKVLDLLISYG
ILKPDLRILFIHNKAVVWQKTRASDHKMALLSVLGTAVMGNMEPFQYHSEEAQIYLSGFL
PKHDADHSSTSLSTPERSFIFINSRPIHQKDILKLIRRYYNLKCLKESTRLYPIFFLKID
VPTANVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGSLPSTNSYENSKTDVSSADMAV
SKKAETDVLFNKTESSGSNYPNVDTSSISFQNDVHADESGENINGCLNHIHVHDHYDDHF
ISENSNTDNTKNTFLEIPMDNLSSEDTQKEYTETCFVGSVTQAQSENGRIDESGGNEKEA
VPEKSVEICADNWSRGNALKNAMGENIEPVKILVPPGSSACEGSERSPPSPEQKSLDDGS
CNKKSNVVDHKSGQLTAYDLISRRVIKKPMSASALFVQDHRVQFLTENPQTSLEAAAIQI
EELWKTLSEEEKLKYEERATKDLERYSRQIKRAIEQESQTSLQDGRKKMKPTSSWSLAQK
HKLKTSLSNQPKLDELFQSQVEKKKSQTIKIVQIHFSMENFKKNVEKHKKFEPEERDELC
LIHNLKFPDGWLVTSKTEVMLLNPYRVEEALLFKRLLENHKLPAEPLEKPIILTESLFNG
SHYLEILYKMTAGDQSYSGSTYLSDPRLTANGFKIKLIPGVSIAENYLEIEGMANCLPFY
GVMDLKEILNAIVNKNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDIIYRMK
HQFGNEIKGCVHGRPFFHHLTHLPEAT
Download sequence
Identical sequences G1PPU4
XP_006098452.1.53796 ENSMLUP00000013049 ENSMLUP00000013049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]