SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013106 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013106
Domain Number 1 Region: 372-518
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.41e-23
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 
Domain Number 2 Region: 561-675
Classification Level Classification E-value
Superfamily PX domain 6.41e-23
Family PX domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013106   Gene: ENSMLUG00000014405   Transcript: ENSMLUT00000014414
Sequence length 958
Comment pep:putative scaffold:Myoluc2.0:GL429782:12220322:12298559:-1 gene:ENSMLUG00000014405 transcript:ENSMLUT00000014414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALFQTSLSIWGWGSLGVVLSLITFGPFVIFYLAFYILCFVGGGFVVTLLFGKTNSEKYLE
QCEHSFLPPTSTGIPKCLEEMKREAGTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKIT
EKDDQVTAGSAEDLVETFFEVEVEMEKDVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPG
DFQNKTMRYFVREILAQGILLPLINQLSDPDYINQYIIWMIRESNCNYEAFMNIIKLSDN
IGELEAVRDKAIEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINT
VKLAANFGKLCTVPLASILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLQV
LLSRQKDGKHQTNQTKGLLRAAAVGIYDQYLSEKASPRVTVDDYLVAKLADTLNHEDPTP
EIFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSP
TGSINLSLDDLSNVSSDDLIQLHAYISDTGVCNDHGKTYALYAITVHRRNLNSEEMWKTY
RRYSDFHDFHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMM
KAFPVLAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMT
KMSDNMGRMSERLGQDIKQSFFKMPPLIPKTDSDPEHCRVSAQLDDTVDDNIPLRVMLLL
MDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADLVKRFRD
AFWPNGILAEAVPCRDKAIRMRTRIAGKTKLLSIMPDELKHIIGAETTRKGILRVFEMFQ
HNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSMQMQKYKQKLQTSQAPSLQKR
Download sequence
Identical sequences G1PPZ0
ENSMLUP00000013106 ENSMLUP00000013106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]