SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Myotis lucifugus 69_2.0 > ENSMLUP00000013318

Domain assignment for ENSMLUP00000013318 from Myotis lucifugus 69_2.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMLUP00000013318
Domain Number 1	Region: 30-269
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	2.9e-36
Family	Ankyrin repeat	0.00052
Further Details:

Domain Number 2	Region: 287-333
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.00000085
Family	SOCS box-like	0.007
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMLUP00000013318 Gene: ENSMLUG00000014634 Transcript: ENSMLUT00000014638
Sequence length	334
Comment	pep:putative scaffold:Myoluc2.0:GL430660:124034:136975:-1 gene:ENSMLUG00000014634 transcript:ENSMLUT00000014638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAEGGGPDGRAGPGPAGPNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEE SYRSRINEKSVWCCGWLPCTPLRIAATAGHGNCVDFLIRKGAEVDLVDVKGQTALYVAVV NGHLESAQILLEAGADPNGSRHHRSTPVYHASRVGRADILKALIRYGADVDINHHIFPDI RPPFSRRLTSLVVCPLYISAAYHNLQCFKLLLQAGANPDFNCNGPVNTQGFCRGSPGCVM DAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRRRKVDPEALQVFKEARSVPRALLN LCRVAVRRALGKYRLHLIPSLPLPDPIKKFLLYE
Download sequence
Identical sequences	G1PQG7 ENSMLUP00000013318 ENSMLUP00000013318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]