SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Myotis lucifugus 69_2.0 > ENSMLUP00000014051

Domain assignment for ENSMLUP00000014051 from Myotis lucifugus 69_2.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMLUP00000014051
Domain Number 1	Region: 37-132
Classification Level	Classification	E-value
Superfamily	SH2 domain	1.21e-26
Family	SH2 domain	0.00000182
Further Details:

Domain Number 2	Region: 150-197
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.0000000000000131
Family	SOCS box-like	0.0000658
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMLUP00000014051 Gene: ENSMLUG00000015422 Transcript: ENSMLUT00000015420
Sequence length	198
Comment	pep:putative scaffold:Myoluc2.0:GL429776:15928018:15930230:1 gene:ENSMLUG00000015422 transcript:ENSMLUT00000015420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTLRCVEPSGNGAEGTRSQWGTAGSAEEPSPEAAPLAKALRELSQTGWYWGSMTVNEAKE KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGAIWG LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences	G1PSB1 ENSMLUP00000014051 ENSMLUP00000014051 XP_006084090.1.53796 XP_006084091.1.53796 XP_006084092.1.53796 XP_006084093.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]