SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015416 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015416
Domain Number 1 Region: 2692-2804
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 3160-3285
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 3 Region: 1052-1158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 4 Region: 931-1040
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-34
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 5 Region: 1625-1733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 6 Region: 589-701
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-34
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 7 Region: 1395-1507
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-34
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 8 Region: 1164-1275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-34
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 9 Region: 3408-3512
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-33
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 10 Region: 2335-2447
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-33
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 11 Region: 2227-2334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-32
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 12 Region: 3040-3152
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 13 Region: 2451-2564
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-32
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 14 Region: 1509-1618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-32
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 15 Region: 1738-1847
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00072
Further Details:      
 
Domain Number 16 Region: 1278-1387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-30
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 17 Region: 1989-2089
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-29
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 18 Region: 1857-1964
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-27
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 19 Region: 3516-3623
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-27
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 20 Region: 2091-2212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-27
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 21 Region: 823-926
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-25
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 22 Region: 707-813
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-25
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 23 Region: 468-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-25
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 24 Region: 2919-3038
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-25
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 25 Region: 2570-2676
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-21
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 26 Region: 2808-2921
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-21
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 27 Region: 3291-3399
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-18
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 28 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000429
Family EGF-type module 0.012
Further Details:      
 
Domain Number 29 Region: 432-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000274
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 30 Region: 392-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000377
Family EGF-type module 0.013
Further Details:      
 
Domain Number 31 Region: 302-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000762
Family EGF-type module 0.017
Further Details:      
 
Domain Number 32 Region: 170-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000892
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 33 Region: 209-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000119
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 34 Region: 353-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000073
Family EGF-type module 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015416   Gene: ENSMLUG00000016887   Transcript: ENSMLUT00000016915
Sequence length 3629
Comment pep:putative scaffold:Myoluc2.0:GL429888:2599321:2881349:1 gene:ENSMLUG00000016887 transcript:ENSMLUT00000016915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRNMSSSFRWSVVILLTFAKSDGETGRLELQSQTRITDLQQPRMATERGNLVFLTGSAQN
IEFKTGSLGKIKLNDEDLGECLQQIQKNKDDIADLKRSAGGLPQNISSQIHQLNSKFVDL
ERKVQSLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPSQWKGPLCSADVNECEIYAGT
PFGCQNGATCINTVGSYSCLCSPETHGPQCASKYDDCEAGSKALCVHGICEDQVRIQAGQ
PKYSCICDAGWTSPQNSSACTLDRDECNLWPAPCSELVQCFNTPGSFYCGACPTGWQGNG
YYCQDVNECETNNGGCSVAPPVECVNTPGSFHCQACPPGYQGDGRVCTLIDVCSVNNGGC
HPQASCSPGPGSLPFCTCLPGYTGNGFGPNGCVQLSNMCLSRPCLNGQCIDTVSGYLCKC
ESGWAGINCTENINECLSNPCLNGGTCVDGINAFSCECTRFWTGFLCQIPQQVCGGSLSG
VNGSFSYKSPDVGYVHDVNCFWVVRTEERKVLRITFTFFQLESVSNCPHEFLQIHDGDSS
AAFQLGRFCGSSTPHELLSSDNALYFHFYSEHLRNERGFTIRWETQQPECGGILTGTYGS
IKSPGYPGNYPPGRDCVWRVITSPGLVITFAFGTLSLEHHDDCSKDYLEIRDGPLSQDPV
LGKFCTTLSAPPLQTTGPFARVHFHSDDQISDQGFYITYLTSPSDPPCGGNYTDPEGVLS
LDLNGPFTQNKHCIYVIQQPLGEQIQVNFTHVELEGQSGCSPSYIEVRDDDTLLGKVCGN
ETLSHIKSITNSIWIRFIIDASVEKAGFSAVYQVACGGELTGEGVIRSPYYPNVYPGERI
CRWAIHQPQSQVVLLNFTGFEIGSSAHCDTDYIEIGSSSILGSTENKKYCGTDIPLLITS
VYNFLHVIFVKSSSTENHGFMAKFSTKDLACGKTLTEPTGIIQSPGHPNIYPHGISCTWY
ISVQPGFLINLIFRRFHLEFHYNCTSDYLEVYDTGSGTSLGRYCGKSVPPSLISSNSSLT
LVFVADSDLAYEGFLIEYESTNASAVCLKDYTEESGTFTSPNFPNNYPNNWKCIYRITVG
TSQQIALHFTNFSLEEEFGGKCLGDFVEIKDGGYETSPLLGKYCGSTTPPRIISHSNKLW
LQFKSDIVVSSSGFSAYWDGSLTGCGGNLTTPTGTFTSPNYPMPYYHSSECYWWLKASQG
SPFELEFEEFHLEHHPNCTLDYLAVYDGPSTSSHLLTQLCGNEKPPLIRSSGDSMFLKLR
TDEHQQGGGFLAKYHQTCENVMIVNRTYGILESIHYPNPYSDNQRCNWTIQATTGNTVNY
TFLEFELENHLNCSHDYLELYDGSRRIGRYCGADMPPSGSTAGSVLQVLFHTDGVGNKEK
GFQMQWFVHGCGAELSGAMGSFSSPGYPNTYPPSKECIWYIHTAPGSSIQLTIHDFDVEY
HESCGFDVLEIYGGPDFHSPRIAQLCTRRSPENPMQVSSTGHELAIRFKTDSMVSGRGFN
VSWQAVPGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRAERNHRVLLNFTDFDLEPQ
DSCIIAYDGLSSATTRLARACGRQQLTNPITSSGNSLFVRFQSGPSRQSRGFQAHFRQVC
GGYILTDSFDTISSPLFPAKYPDNQNCSWIIQAQPPFNHITLSFTHFGLESSTTCTQDFL
EILDGNYDDAPLRGRYCGTSMPHPITSFSNALTLRFISDSSVSFGGFHATYAASSSACGG
DFHMAEGTFDSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCSRDFVEIRA
ENATGHLVGRYCGNTLPLNYSSIVEHSLWIRFVSDGSGSGTGFQATFANIFGNDNIVGTH
GKVASPLWPGNYPHNSDYQWIVNVNASQVVHGRILEMDIESTHNCYYDKLRIYDGAGIHS
RPIGTYCGAQTDSFSSTGSSLTFQFSSDSSVSGKGFLLEWFAVDAAVGPLPTIATGACGG
FLRTGEAPAFLFSPGWPQNYGNRADCVWLIQAPDSTVELNILSLDIESHGTCNYDKLVIR
DGDNNMAQQLAVLCGREIPGPIRSTGEYMWLRFTSDFSVTRAGFNASFHKSCGGYLHANR
GIITSPNYPETYPPNLNCSWHVLVQSGLTIAVHFEQPFQIANGDSSCNEGDYLGLRNGPD
ISSPPMGPHGGNGHFCGSRPSSTLFTSDHQMFVQFISDNSNGGQGFKIRYEAKSLACGGN
IYIHDVDSVGYVTSPNHPDNYPQHADCIWLIAAPPGKLIRLQFEDQFNIEVTPNCTSNYL
ELRDGADSNAPIISKLCGTSLPRSQLSSGEVIYLRFRSDNNSTHVGFKAKYSIAQCGGTL
TGQSGVIQSVGYPTLAYSDNLLCEWHLRGPSGHYLTIHFEDFNLQNSSGCEKDFVEIWEN
HTSGNLLGRYCGNIIPDSVDTSSNVALVRFVTDDSLTASGFRLRFESSLEECGGDLQGPT
GTFTSPNYPNPNPHGRICEWRITVQEGRQVTLTFNNLRLEAHPSCNSERVTVFNGIRSNS
PVLGKLCSSVNISDEIKSSGNTMKVIYFTDGSRPYGGFSASYTSSEDAVCGGALTNSPEG
NFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFENFYLESHQDCQFDVLEFRVGNA
DGPLIWRLCGPVASTVPLVIPYSQVWIHFVTNERVEHTIDKNFHNVTNLISDCGGIQTGE
SGVITSPNYPASYDSLTHCAWLLEVPQGDTITLTFSDFDIESQSTCAWDSVTVRNGGSPG
SPIIGHYCGTSSPSPIQSGSNQLVVIFNSDHSVQNGGFYATWSMHTLGCGGILHSDNGTI
RSPHWPQNFPENSRCSWTVITHESNHLEISFDNNFLIPSGDGQCHNSFVKVWAGTEEMDK
ALLATSCGNVAPGAIITPRNAFTAVFQSQEAPAPGFSASFVSRCGSNFTKPSGYIISPNY
PKQYDNNMNCTYFIEANPLSVVFLTFVSFHLEARSAVTGSCDNDGLHIIRGHSVASTPFA
TVCGDEVLSPVTISGPVLLNFYSNSHTTDFGFKLSYQITSCGGVFNFSTGIIKSPAYSYS
DYPNNMYCLYNITVRDNKVILLKFTHFDVALSTSCSQDYLAIYDGYNISDPLLGKFCGSK
LPPNVKSSNNSMLLVFKTDAFQTARGWVITFRQTLDTGPQQGCGGYLTGSNSTFASPDSD
ANGRYDKNLNCIWFIIAPVNKLIKLTFNTFALESASALQRCIYDYVKLYDGESENAKLAG
TFCGSTVPAPFVSSGNFLTVQFVSDISLEREGFNATYTFINMICGGTYNATWTPQNISSP
NASNPDVPLSTCTWVFEAPPHQQVEITVWAFQLQSRDCHQNYLEFQDTPESSGNARIHLC
GRNATAVPTFYSSMSTAIVIFKSEVFNDNSRVSFTYQIAGCNRNYKKAFGNLKSPGWPAN
YNNDMDCTVTLTAPQNHSISLFFHSFGIEDSSECRHDFLEVRNGSDSSSPLLGTYCGTLL
PNPIFSQNNELYLRFKSDSATSSRGYEIIWTSSPSGCGGTLYGDHGSFTSPGYPGTYPNH
THCEWAITAPAGRLVTVNFYFISIDDPGDCVQNYLILYDGPDVNSPSSGPYCGTDTNIAP
FVASSHRVFIEFHAEYAVRPSAIQLTWDS
Download sequence
Identical sequences G1PVN9
ENSMLUP00000015416 ENSMLUP00000015416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]